P2DFlow / models /add_module /model_utils.py
Holmes
test
ca7299e
import numpy as np
import torch
import torch.nn as nn
import torch.nn.functional as F
from opt_einsum import contract as einsum
import copy
# from utils.constants import *
# from utils.structure_utils import rigid_from_3_points
# from scipy.spatial.transform import Rotation as scipy_R
# def init_lecun_normal(module):
# def truncated_normal(uniform, mu=0.0, sigma=1.0, a=-2, b=2):
# normal = torch.distributions.normal.Normal(0, 1)
# alpha = (a - mu) / sigma
# beta = (b - mu) / sigma
# alpha_normal_cdf = normal.cdf(torch.tensor(alpha))
# p = alpha_normal_cdf + (normal.cdf(torch.tensor(beta)) - alpha_normal_cdf) * uniform
# v = torch.clamp(2 * p - 1, -1 + 1e-8, 1 - 1e-8)
# x = mu + sigma * np.sqrt(2) * torch.erfinv(v)
# x = torch.clamp(x, a, b)
# return x
# def sample_truncated_normal(shape):
# stddev = np.sqrt(1.0/shape[-1])/.87962566103423978 # shape[-1] = fan_in
# return stddev * truncated_normal(torch.rand(shape))
# module.weight = torch.nn.Parameter( (sample_truncated_normal(module.weight.shape)) )
# return module
# def init_lecun_normal_param(weight):
# def truncated_normal(uniform, mu=0.0, sigma=1.0, a=-2, b=2):
# normal = torch.distributions.normal.Normal(0, 1)
# alpha = (a - mu) / sigma
# beta = (b - mu) / sigma
# alpha_normal_cdf = normal.cdf(torch.tensor(alpha))
# p = alpha_normal_cdf + (normal.cdf(torch.tensor(beta)) - alpha_normal_cdf) * uniform
# v = torch.clamp(2 * p - 1, -1 + 1e-8, 1 - 1e-8)
# x = mu + sigma * np.sqrt(2) * torch.erfinv(v)
# x = torch.clamp(x, a, b)
# return x
# def sample_truncated_normal(shape):
# stddev = np.sqrt(1.0/shape[-1])/.87962566103423978 # shape[-1] = fan_in
# return stddev * truncated_normal(torch.rand(shape))
# weight = torch.nn.Parameter( (sample_truncated_normal(weight.shape)) )
# return weight
# # for gradient checkpointing
# def create_custom_forward(module, **kwargs):
# def custom_forward(*inputs):
# return module(*inputs, **kwargs)
# return custom_forward
# def get_clones(module, N):
# return nn.ModuleList([copy.deepcopy(module) for i in range(N)])
class Dropout(nn.Module):
# Dropout entire row or column
def __init__(self, broadcast_dim=None, p_drop=0.15):
super(Dropout, self).__init__()
# give ones with probability of 1-p_drop / zeros with p_drop
self.sampler = torch.distributions.bernoulli.Bernoulli(torch.tensor([1-p_drop]))
self.broadcast_dim=broadcast_dim
self.p_drop=p_drop
def forward(self, x):
if not self.training: # no drophead during evaluation mode
return x
shape = list(x.shape)
if not self.broadcast_dim == None:
shape[self.broadcast_dim] = 1
mask = self.sampler.sample(shape).to(x.device).view(shape)
x = mask * x / (1.0 - self.p_drop)
return x
def rbf(D, D_min = 0., D_max = 20., D_count = 36):
'''
D: (B,L,L)
'''
# Distance radial basis function
D_mu = torch.linspace(D_min, D_max, D_count).to(D.device)
D_mu = D_mu[None,:]
D_sigma = (D_max - D_min) / D_count
D_expand = torch.unsqueeze(D, -1)
RBF = torch.exp(-((D_expand - D_mu) / D_sigma)**2) # (B, L, L, D_count)
return RBF
# def get_centrality(D, dist_max):
link_mat = (D < dist_max).type(torch.int).to(D.device)
link_mat -= torch.eye(link_mat.shape[1], dtype = torch.int).to(D.device)
cent_vec = torch.sum(link_mat, dim=-1, dtype = torch.int)
return cent_vec, link_mat
def get_sub_graph(xyz, mask = None, dist_max = 20, kmin=32):
B, L = xyz.shape[:2]
device = xyz.device
D = torch.cdist(xyz, xyz) + torch.eye(L, device=device).unsqueeze(0)* 10 * dist_max # (B, L, L)
idx = torch.arange(L, device=device)[None,:] # (1, L)
seq = (idx[:,None,:] - idx[:,:,None]).abs() # (1, L, L)
if mask is not None:
mask_cross = mask.unsqueeze(2).type(torch.float32)* mask.unsqueeze(1).type(torch.float32) # (B, L, L)
D = D + 10 * dist_max * (1 - mask_cross)
seq = seq * mask_cross # (B, L, L)
seq_cond = torch.logical_and(seq > 0, seq < kmin)
cond = torch.logical_or(D < dist_max, seq_cond)
b,i,j = torch.where(cond) # return idx where is true
src = b*L+i
tgt = b*L+j
return src, tgt, (b,i,j)
def scatter_add(src ,index ,dim_index, num_nodes): # sum by the index of src for a source node in the graph
out = src.new_zeros(num_nodes ,src.shape[1])
index = index.reshape(-1 ,1).expand_as(src)
return out.scatter_add_(dim_index, index, src)
# # Load ESM-2 model
# model, alphabet = esm.pretrained.esm2_t33_650M_UR50D()
# batch_converter = alphabet.get_batch_converter()
# model.eval() # disables dropout for deterministic results
# def get_pre_repr(seq):
# Prepare data (first 2 sequences from ESMStructuralSplitDataset superfamily / 4)
# data = [
# ("protein1", "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG"),
# ("protein2", "KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEE"),
# ("protein2 with mask","KALTARQQEVFDLIRD<mask>ISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEE"),
# ("protein3", "K A <mask> I S Q"),
# ]
seq_string = ''.join([aa_321[num2aa[i]] for i in seq])
data = [("protein1", seq_string)]
batch_labels, batch_strs, batch_tokens = batch_converter(data)
batch_lens = (batch_tokens != alphabet.padding_idx).sum(1)
# Extract per-residue representations (on CPU)
with torch.no_grad():
results = model(batch_tokens, repr_layers=[33], return_contacts=True)
node_repr = results["representations"][33][0,1:-1,:]
pair_repr = results['attentions'][0,-1,:,1:-1,1:-1].permute(1,2,0)
# Generate per-sequence representations via averaging
# NOTE: token 0 is always a beginning-of-sequence token, so the first residue is token 1.
# sequence_representations = []
# for i, tokens_len in enumerate(batch_lens):
# sequence_representations.append(token_representations[i, 1 : tokens_len - 1].mean(0))
# Look at the unsupervised self-attention map contact predictions
# for (_, seq), tokens_len, attention_contacts in zip(data, batch_lens, results["contacts"]):
# plt.matshow(attention_contacts[: tokens_len, : tokens_len])
return node_repr, pair_repr