text
stringlengths 13
30k
|
|---|
{"text": "juxtafacet cysts ( jfcs ) are uncommon intraspinal , extradural lesions that arise from the facet joints .\njfcs can be further distinguished as either synovial cysts , if histology confirms the presence of a synovial lining membrane , or alternatively as a ganglion cyst , if no such membrane is present .\nhowever , few differences exist between the two in terms of diagnosis and management.1 \n 2 \n 3 \n 4 \n 5 \n 6 \n 7 their pathogenesis remains unclear , with most authors citing excessive joint mobility leading to synovial fluid herniation through joint capsule defects.2 \n 4 \n 7 \n calcification in the cyst walls is a common finding on imaging for jfcs , appearing as peripheral areas of high attenuation on computed tomography ( ct ) and peripheral hypointensity on t1- and t2-weighted magnetic resonance imaging ( mri).8 \n 9 \n 10 but although calcification of the cyst walls are commonly reported findings,9 \n 10 \n 11 complete calcification of the cyst is exceedingly rare.11 \n 12 \n 13 we present here an unusual case of a jfc presenting as a giant , multilobular , completely calcified mass with significant extraforaminal extension .\nthe patient was a 57-year - old woman who presented with a 2-year history of gradually worsening lower back and left leg pain .\nshe also reported numbness in her left heel and foot and subjective weakness in the left foot .\nher past medical history was significant for hypothyroidism , hypertension , mild levoscoliosis , rheumatoid arthritis , and scleroderma managed on weekly methotrexate injection .\nher past surgical history was negative for any previous lumbar surgeries , but the patient had received multiple cervical surgeries resulting in c3c7 fusion . on neurologic exam ,\nthe patient was found to have decreased strength in plantarflexion and dorsiflexion of the left lower extremity but was otherwise nonfocal .\nthe patient 's imaging was most notable for a large , multilobular mass , measuring 54 31 30 mm , arising from the left l5s1 facet joint that had caused destruction of the joint itself and that showed severe encroachment of the adjoining foramen , with coexisting grade i anterolisthesis of l5 on s1 .\nthe lesion was hyperdense on plain radiograph ( fig . 1 ) and on ct imaging ( fig\n. 2a , 2b , and 2c ) and appeared hypointense on t1- and t2-weighted mri sequences ( fig .\npreoperative plain film of the lumbar spine showing a large , completely calcified lesion extending out from the l5s1 intervertebral space . \n\n( a ) axial computed tomography ( ct ) image taken preoperatively , showing the origin of the lesion from the left l5s1 facet joint .\n( b ) a preoperative midsagittal ct image demonstrating grade 1 anterolisthesis of l5 on s1 . ( c ) a preoperative sagittal ct image demonstrating foraminal stenosis at l5s1 caused by the lesion . \n ( a ) t1-weighted magnetic resonance image ( mri ) of the same lesion , which appears uniformly hypointense . ( b )\nthe patient underwent an l5 laminectomy for excision of the mass along with an l5 to s1 fixation and fusion .\nintraoperatively , the lesion was noted to consist of a pastelike material that was compressing the thecal sac and that extended ventrally out of the foramen .\nhistologic analysis identified the lesion as a mineralized simple pseudocyst , containing mineralized proteinaceous material that did not refract plane polarized light after ethanol fixation ( fig . 4a and 4b ) .\n( a ) hematoxylin and eosin stained sections of the resection reveal dense membranous fibrous connective tissue separating spaces associated with dense calcifications as well as smaller loculated spaces filled with calcium ( 20 magnification ) .\n( b ) higher magnification ( 40 ) reveals the wall of the spaces to be associated with granular calcifications and no obvious cellular lining .\nthe patient experienced no intraoperative or postoperative complications , and her postoperative hospital course was unremarkable . by postoperative day 2 , the patient had recovered full strength in her extremities but still had some residual numbness , and she was discharged to home in stable condition on postoperative day 3 . at 2-year follow - up ,\nthe patient continued to be free of her lower extremity pain and weakness and had not experienced any subsequent postsurgical complications ( fig . 5a and 5b ) . \n\n( a ) postoperative plain film ( anterior - posterior ) showing removal of the mass and placement of fixation hardware .\nmineralized , extradural lesions of the lumbar spine arising from the facet joint are uncommon causes of spinal pathology .\nthe differential diagnosis consists of several uncommon disorders , including synovial osteochondromatosis,14 tumoral calcinosis,15 tumoral calcium pyrophosphate dehydrate crystal deposition disease ( pseudogout),16 and lumbar presentation of ossification of the ligamentum flavum.17 the case we present here represents another potential consideration in that differential diagnosis .\ncompletely calcified jfcs are rare , with only a handful of instances existing in the literature .\nalmefty et al presented four patients with multiple - level , bilateral , consistently calcified thoracic spinal cysts.12 these lesions were atypical due to their number , location , and mineralization .\nkasliwal and deutsch presented on the case of a unilateral lumbar jfc at the l4l5 level.13 similar to our case , the patient presented with radicular symptoms in the setting of a lumbar lesion that appeared hypointense on t1- and t2-weighted mri .\nit should be noted that calcification of jfcs can result from treatment as well , as mtellus et al noted a case of a cyst undergoing complete calcification after intracystic steroid injection therapy.11 \n the case presented here was remarkable not just for its mineralization but also for its size .\njfcs have typically been recorded to be between 10 and 20 mm in diameter at their widest dimension on imaging.10 \n 18 the case we report here , however , measured 54 mm at its widest dimension , showing significant extension into nearby structures .\nmoreover , although jfcs frequently extend into the spinal canal and cause compression of the thecal sac,2 the majority of the lesion in our case existed outside the spinal canal .\nthis may explain how the cyst grew to be so large before the patient presented for evaluation .\nit should also be noted that our patient 's medical history included rheumatoid arthritis and scleroderma , and systemic inflammatory diseases have been associated with jfcs in the past.1 \n 19 moreover , inflammatory arthritides are known to contribute to the pathogenesis of synovial cysts outside of the spine.20 however , no studies to date have established systemic inflammation as a risk factor for jfc development , and the role of inflammatory joint disease in the pathogenesis jfcs remains unclear .\nmany methods of treating jfcs have been described , including simple laminotomy with cystectomy and the potential addition of a laminectomy , hemilaminectomy , mesial facetectomy , or foraminotomy.3 \n 4 minimally invasive approaches with tubular retractors have also been described.19 \n 21 in terms of treatment of this patient , it was presumed that the symptoms of back pain were secondary to facet dysfunction and that the left - sided plantar flexion weakness was due to foraminal stenosis . due to the size and mineralization of the lesion\n, it was felt that a complete facetectomy was needed to adequately address the underlying pathology , necessitating a concurrent fusion .\nour case highlights the significant variation that exists in the size , location , and content of jfcs .\nalthough uncommon , jfcs should be considered in the differential diagnosis of lesions arising from the facet joint , even if they appear calcified and noncystic in nature .", "target": " \n study design case report . \n \n objective to report the case of one patient who developed a giant , completely calcified , juxtafacet cyst . \n methods a 57-year - old woman presented with a 2-year history of progressively worsening lower back pain , left leg pain , weakness , and paresthesias . \n imaging showed a giant , completely calcified mass arising from the left l5s1 facet joint , with coexisting grade i l5 on s1 anterolisthesis . \n the patient was treated with laminectomy , excision of the mass , and l5s1 fixation and fusion . \n \n results the patient had an uncomplicated postoperative course and had complete resolution of her symptoms as of 1-year follow - up . \n \n conclusions when presented with a solid - appearing , calcified mass arising from the facet joint , a completely calcified juxtafacet cyst should be considered as part of the differential diagnosis . ", "evaluation_predictions": [2, 145, 799, 264, 109, 437, 113, 114, 1532, 6632, 122, 47639, 445, 55127, 110, 108, 423, 110, 108, 1127, 57488, 28394, 110, 108, 911, 1897, 1524, 25391, 110, 108, 1546, 43740, 19221, 110, 108, 19043, 757, 3220, 7998, 93420, 92660, 113, 109, 47639, 24380, 113, 109, 518, 1074, 3928, 110, 107, 106, 109, 1532, 140, 114, 8995, 121, 1019, 233, 459, 1590, 170, 1848, 122, 47639, 445, 55127, 110, 108, 423, 110, 108, 1127, 57488, 28394, 110, 108, 911, 1897, 1524, 25391, 110, 108, 1546, 43740, 19221, 19043, 757, 3220, 7998, 92660, 113, 109, 47639, 24380, 113, 109, 518, 1074, 3928, 110, 107, 106, 109, 1532, 140, 114, 8995, 121, 1019, 233, 459, 1590, 170, 1848, 122, 47639, 445, 55127, 110, 108, 423, 110, 108, 1127, 57488, 28394, 110, 108, 911, 1897, 1524, 25391, 110, 108, 1546, 43740, 19221, 19043, 757, 3220, 7998, 92660, 113, 109, 47639, 24380, 113, 109, 518, 1074, 3928, 110, 107, 106, 109, 1532, 140, 114, 8995, 121, 1019, 233, 459, 1590, 170, 1848, 122, 47639, 445, 55127, 110, 108, 423, 110, 108, 1127, 57488, 28394, 110, 108, 911, 1897, 1524, 25391, 110, 108, 1546, 43740, 19221, 19043, 757, 3220, 7998, 92660, 113, 109, 47639, 24380, 113, 109, 518, 1074, 3928, 110, 107, 106, 109, 1532, 140, 114, 8995, 121, 1019, 233, 459, 1590, 170, 1848, 122, 47639, 445, 55127, 110, 108, 423, 110, 108, 1127, 57488, 28394, 110, 108, 911, 1897, 1524, 25391, 110, 108, 1546, 43740, 19221, 19043, 757, 3220, 7998, 92660, 113, 109, 47639, 24380, 113, 109, 518]}
|
{"text": "panax ginseng ( ginseng ) has been used traditionally in eastern asia over thousands of years .\nit has been used orally to treat various diseases including hypertension , diabetes mellitus , liver and kidney dysfunction , mental disorders , and postmenopausal disorders .\nin addition , topical applications have also been used to heal wounds and reduce skin inflammation . in the past few decades\n, it has been proved that ginseng extracts actually show a wide range of effects against human diseases .\ntheir potential therapeutic effects have been mainly attributed to its immunomodulatory , neuroprotective , antioxidative , antitumor , and hepatoprotective activities .\nginseng contains a number of active ingredients including ginsenosides , polysaccharides , phytosterols , peptides , polyacetylenes , fatty acids , and polyacetylenic alcohols , which have different effects on carbohydrate and lipid metabolism , cognition , angiogenesis , and the neuroendocrine , immune , cardiovascular , and central nervous systems . among the active constituents of ginseng ,\nginsenosides are known to be the major biologically active components of ginseng and the most widely studied .\nseveral studies have shown that ginsenosides play important roles in the pharmacological effects of ginseng .\n. however , ginseng contains other constituents , including ginsenoyne , phenolic compounds , polyacetylenes , sesquiterpenes , methoxypyrazine , alkylpyrazine derivatives , sesquiterpene alcohols , panasinsanols , and -carboline .\nwhite ginseng is peeled , dried , ginseng root and red ginseng is produced by steaming fresh ginseng root at 98100c for 23 h , and then drying until the moisture content is < 15% .\nred and white ginseng have both been shown to have immunomodulatory , anti - inflammatory , antioxidant , and antiatopic activities . moreover ,\nred ginseng has been reported to have more potent pharmacological activities than white ginseng in some respects [ 2022 ] .\nthe differences in biological activities between red and white ginseng are caused by the chemical changes of ginsenosides after the steaming process .\nsteaming partially converts the original ginsenosides to deglycoslated derivatives . as a result , the species and amounts of ginsenosides are quite different based on the processing method used .\nchu et al showed that a total of 53 and 43 compounds were tentatively identified in white ginseng and red ginseng samples , respectively .\nthe featured compounds are mainly malonyl ginsenosides in white ginseng , and decarboxyl products of mal - ginsenosides and the dehydrated compounds from polar ginsenosides were characteristic in red ginseng .\nit is interesting that ginsenosides show a wide variety of biological activities , although the absorption rates from orally administered intact ginsenosides are very low . in the human intestinal tract ,\nthus , the pharmacological actions of these ginsenosides have been closely related to their biotransformation by human intestinal bacteria . in this context\nseveral studies showed that the transformation of ginsenosides into deglycosylated ginsenosides is needed to increase ginseng 's effectiveness in vivo \n .\nabnormal changes in skin color induce significant cosmetic problems with a negative effect on quality of life .\nthere are two groups of pigmentary disorders : disorders of the quantitative and qualitative distribution of normal pigment and the abnormal presence of exogenous or endogenous pigments in the skin .\nhyperpigmentation - related diseases include melasma , lentigines , nevus , ephelis , freckles , postinflammatory hyperpigmentation , and age spots .\npostinflammatory hyperpigmentation appears in many skin conditions , including acne , eczema , and contact dermatitis .\nskin color is determined by various factors including melanin content , oxygenation state of hemoglobin in capillary vessels , carotenoid content , water content , and organization of collagen fibers in the dermis . among these factors , melanin is the major determinant of skin color . in this context ,\nmelanogenesis is a biochemical pathway responsible for melanin synthesis that is controlled by complex regulatory mechanisms .\nmelanogenesis occurs in melanocytes confined in separate cytoplasmic organelles called melanosomes , which contain key enzymes of melanogenesis .\ndifferences in skin color are related to the size , number , shape , and distribution of melanosomes , whereas melanocyte density typically remains relatively constant .\nalthough tyrosinase is the key regulatory enzyme of melanogenesis , tyrosinase - related protein ( trp)-1 , dopachrome tautomerase ( dct / trp2 ) , and melanosomal matrix proteins ( pmel17 , mart-1 ) carry out important roles in regulating melanogenesis .\nthe genes of tyrosinase , trp-1 , and dct contain common transcription starting sites , the microphthalmia - associated transcription factor ( mitf ) binding sites .\nthe intracellular signal transduction pathways of protein kinase c , cyclic amp ( camp ) , and nitrogen oxide are involved in the regulation of melanogenesis .\nvarious endogenous and exogenous factors , such as estrogen and ultraviolet ( uv ) radiation , affect melanogenesis via signal transduction pathways .\nthese endogenous / exogenous factors exert their actions directly on melanocytes or indirectly via surrounding skin cells .\nmelanocytes , keratinocytes , dermal fibroblasts , and other skin cells communicate with each other by factors that are secreted and cell cell contacts .\nit has been shown that the interactions between keratinocytes and melanocytes are critical in the regulation of melanogenesis .\nin addition , dermal factors have been found to be involved in the regulation of melanogenesis . at the same time , stimulated melanocytes secret a number of signal molecules targeting not only keratinocytes but also skin immune cells .\nsoluble factors released by melanocytes include proinflammatory cytokines and chemokines such as interleukin ( il)-1/1 , il-6 , il-8 il-10 , tumor necrosis factor ( tnf)- , transforming growth factor ( tgf)- , catecholamines , eicosanoids , serotonin , -melanocyte stimulating factor ( -msh ) , and nitric oxide ( no ) .\na variety of hypopigmenting agents including hydroquinone , arbutin , tretinoin , kojic acid , azelaic acid , vitamin c , n - acetylglucosamine , niacinamide , linoleic acid , ellagic acid , methimazole , dioic acid , soy extract , licorice extract , rucinol , and glycolic acid have been used alone or in combination to treat abnormal hyperpigmentation .\nthese agents can interfere with the pigmentation process at several different steps of skin pigmentation .\nhowever , the treatment of hyperpigmented conditions still remains challenging and the results are often discouraging .\nthus there is a need for novel skin - whitening agents that are highly effective and tolerable . in this article\n, we review recent reports investigating the skin - whitening effect of ginseng and its components and the underlying mechanisms of action , and then discuss their potential as candidates for novel skin - whitening agents .\np. ginseng is one of the most widely used medicinal plants in traditional oriental medicine . over thousands of years\n, it has been used to improve the overall condition of skin , as well as to treat a wide variety of diseases . however\n, genuine scientific approaches to clarify the efficacy of ginseng in skin have only been made in recent years .\nseveral reports have shown that ginseng extract , powder , or some other constituents could inhibit melanogenesis in vitro and in vivo . table 1 summarizes the direct effects of ginseng and its components on skin color and key enzymes involved in melanogenesis .\nsong et al reported that red ginseng powder improved melasma in a human clinical trial .\nthey orally administered korean red ginseng powder for 24 weeks to female patients with melasma .\nafter 24 weeks , the melasma area and severity index score decreased and melasma quality of life scale showed improvement in 91% of patients .\nin addition , 74% of the patients showed some improvement on the patient- and investigator - rated global improvement scales .\nmost of reports investigating the antimelanogenic effect of ginseng were conducted in vitro used purified tyrosinase or melanocyte cell lines . in melan - a cells treated with ethanol extract of ginseng seeds , melanin content and\nin addition to the crude extract or powder , several studies tested the effects of specific constituents of ginseng . the phenol compounds inhibited tyrosinase activity while ginsenoside prevents uvb - induced intracellular increase of reactive oxygen species [ 4648 ] . in some reports , ginsenosides alone exerted antimelanogenic effects .\naglycone of ginsenoside rh4 inhibited melanin synthesis in b16 melanoma cells , possibly by involvement of protein kinase a pathway .\nit significantly reduced melanin content and tyrosinase activity in -msh and forskolin - stimulated b16 melanoma cells .\nit reduced the camp level and camp response - element binding protein level in b16 melanoma cells , and this might be responsible for the downregulation of mitf and tyrosinase .\nin addition , ginsenoside rb1 inhibited melanogenesis through the inhibition of tyrosinase activity in -msh - stimulated b16 cells in a dose - dependent manner .\nthe crude methanol extract of the fresh leaves of p. ginseng showed inhibitory activity on mushroom tyrosinase , and p - coumaric acid was characterized as the principal tyrosinase inhibitor in the extract .\np - coumaric acid inhibited melanogenesis in b16f10 melanoma cells stimulated by -msh , and was suggested to interfere with melanogenesis by its structural similarity with tyrosine .\ninterestingly , p - coumaric acid showed weaker inhibition against mushroom tyrosinase but more strongly inhibited human or murine tyrosinase in comparison with kojic acid and arbutin .\nenzyme kinetics analysis indicate that p - coumaric acid is a mixed type ( for tyrosine ) or competitive inhibitor ( for dopa ) of human tyrosinase .\nin addition , p - coumaric acid potently inhibits melanogenesis in human epidermal melanocytes exposed to uvb .\ncinnamic acid , one of the major components of cinnamomum cassia blume , is found in the root and seed of p. ginseng \n .\ncinnamic acid significantly reduced melanin production , tyrosinase activity , and tyrosinase expression in the melan - a cells .\nin addition , cinnamic acid showed depigmenting activity on the uvb - tanned skin of brown guinea pigs .\nit is already known that the pharmacological actions of these ginsenosides have been closely related to their biotransformation by human intestinal bacteria . although the contents of total ginsenosides in red ginseng and fermented red ginseng using lactobacillus brevis were not significantly different , the ginsenoside metabolite content was higher in fermented red ginseng compared to red ginseng .\nthe tyrosinase inhibitory activity of fermented red ginseng extract was more potent compared with red ginseng extract in a test using mushroom tyrosinase .\nas reviewed above , crude extract or some components of ginseng and its components showed antimelanogenic activities by direct inhibition on key enzymes of melanogenesis , such as tyrosinase .\nmoreover , ginseng and its components could exert antimelanogenic activity via action on the several factors related in melanocyte physiology . among a large number of soluble factors produced from melanocytes , keratinocytes , fibroblasts , and immune cells in skin , adrenocorticotropic hormone ( acth ) , -msh , endothelin-1 , prostaglandin e2 , prostaglandin f2 , no , and histamine are well - known stimulators of melanogenesis [ 37,5963 ] .\nil-1/1 and granulocyte - macrophage colony - stimulating factor ( gm - csf ) stimulate melanogenesis , while il-6 , tgf-1 , and tnf- downregulate melanin production .\ngm - csf has been reported to be involved in regulating the proliferation and differentiation of epidermal melanocytes .\ntreatment of melan - a cells with conditioned media from uv - irradiated sp-1 keratinocytes increased melanocyte proliferation , and the proliferative effect of the conditioned media was blocked by anti - gm - csf antibody treatment . when uv - irradiated sp-1 keratinocytes were treated with red ginseng extract or saponin of red ginseng , the increased melanocyte proliferation by the conditioned media was blocked . in that report ,\nred ginseng extract or saponin of red ginseng treatment decreased the expression of gm - csf induced by uv - b irradiation in sp-1 keratinocytes .\nas mentioned above , inflammatory cytokines such as il-1 and tnf- take part in the regulation of melanogenesis .\nginseng extracts and ginsenosides have been reported to have anti - inflammatory activities in several different studies .\nginsenosides inhibit different inducer - activated signaling protein kinases and transcription factor nuclear factor ( nf)-b , and then decrease the production of proinflammatory cytokines and mediators of inflammation .\nkorean red ginseng extracts decreased tnf- and il-8 production in lipopolysaccharide ( lps)-stimulated hacat keratinocytes and show radical scavenging and antioxidant activity in human dermal fibroblasts .\nthese findings suggest that ginseng extracts and ginsenosides might affect melanogenesis through their anti - inflammatory activities . the effect of ginseng on no production is still questionable .\nsun ginseng , a new processed ginseng prepared by steaming at high temperature , reduced uv - b - induced cell damage and decreased no production by inhibition of inducible no synthase mrna synthesis in hacat keratinocytes and human dermal fibroblasts .\nred ginseng marc oil inhibited inducible no synthase and cyclooxygenase-2 via nf-b and p38 pathways in lps - stimulated raw264.7 cells .\nin addition , ginsenjilinol , a protopanaxatriol - type saponin obtained from the roots of p. ginseng , shows inhibitory activity on no production in lps - stimulated raw264.7 cells .\nby contrast , there are some controversial reports that ginseng extract enhanced no production or no signaling .\nhong et al reported that ginseng extract administration stimulated nongenomic endothelial no synthase activation and enhanced no production in spontaneously hypertensive rats . in another report , water extract of korean red ginseng exerted vasoprotective effects through augmentation of no production by inhibiting arginase .\ntherefore , the effect of ginseng on melanogenesis via no signaling remains to be clarified by further study .\nconsiderable numbers of immune cells including langerhans cells , macrophages , mast cells , and t cells are working actively in skin tissue . because the immunostimulatory activities of many ginsenosides are known , it is not surprising that ginsenosides could enhance the reactivity of skin immune cells . in a recent paper ,\na cream containing 0.1% ginsenoside f1 ( a metabolite of ginsenoside rg1 ) showed a significant whitening effect on artificially tanned human skin .\nhowever , ginsenoside f1 did not directly inhibit mrna expression of tyrosinase or dct in normal human epidermal melanocytes .\ninstead , ginsenoside f1 enhanced production of il-13 from human epidermal t cells , and il-13 significantly reduced the mrna expression and protein amount of both tyrosinase and dct resulting in visible brightening of normal human epidermal melanocyte pellets .\nthese results suggest that ginsenosides might be able to regulate melanogenesis via their effect on skin immune cells .\nrecently , several reports have shown that extract , powder , or some constituents of ginseng could inhibit melanogenesis in vivo or in vitro\n. the underlying mechanisms of the antimelanogenic effect of ginseng or its components included the direct inhibition of key enzymes of melanogenesis ( tyrosinase and dct ) , inhibition of transcription factors ( mitf , nf-b ) or signaling pathways ( protein kinase a pathway and protein kinase c pathway ) involved in melanogenesis , decreasing the production of inducers of melanogenesis ( camp , gm - csf ) , and enhancing production of antimelanogenic factor ( il-13 ) . fig . \nalthough issues surrounding the antimelanogenic activity of ginseng still remain controversial , especially in its effect on the production of proinflammatory cytokines and no , these recent findings suggest that ginseng and its constituents might be potential candidates for novel skin - whitening agents .", "target": " abnormal changes in skin color induce significant cosmetic problems and affect quality of life . \n there are two groups of abnormal change in skin color ; hyperpigmentation and hypopigmentation . \n hyperpigmentation , darkening skin color by excessive pigmentation , is a major concern for asian people with yellow brown skin . \n a variety of hypopigmenting agents have been used , but treating the hyperpigmented condition is still challenging and the results are often discouraging . \n panax ginseng has been used traditionally in eastern asia to treat various diseases , due to its immunomodulatory , neuroprotective , antioxidative , and antitumor activities . recently \n , several reports have shown that extract , powder , or some constituents of ginseng could inhibit melanogenesis in vivo or in vitro . \n the underlying mechanisms of antimelanogenic properties in ginseng or its components include the direct inhibition of key enzymes of melanogenesis , inhibition of transcription factors or signaling pathways involved in melanogenesis , decreasing production of inducers of melanogenesis , and enhancing production of antimelanogenic factor . \n although there still remain some controversial issues surrounding the antimelanogenic activity of ginseng , especially in its effect on production of proinflammatory cytokines and nitric oxide , these recent findings suggest that ginseng and its constituents might be potential candidates for novel skin whitening agents . ", "evaluation_predictions": [2, 115, 136, 974, 110, 108, 145, 933, 909, 1574, 124, 109, 769, 233, 15881, 1298, 113, 2712, 17810, 48685, 111, 203, 2274, 111, 109, 5910, 7869, 113, 918, 110, 108, 111, 1693, 153, 866, 130, 2674, 118, 2794, 769, 233, 15881, 3073, 110, 107, 115, 909, 231, 110, 108, 126, 148, 174, 1673, 120, 17852, 116, 17711, 3575, 116, 115, 48685, 403, 114, 827, 809, 113, 7777, 817, 110, 108, 1670, 109, 12126, 1372, 135, 32189, 11175, 11129, 17852, 116, 17711, 3575, 116, 127, 221, 580, 110, 107, 106, 25103, 110, 108, 17852, 116, 17711, 3575, 116, 403, 114, 827, 809, 113, 7777, 817, 115, 109, 883, 24743, 12971, 110, 108, 2297, 110, 108, 109, 63549, 2332, 113, 219, 17852, 116, 17711, 3575, 116, 133, 2851, 985, 112, 153, 5293, 86729, 141, 883, 24743, 5055, 110, 107, 115, 136, 2956, 106, 500, 1683, 2375, 109, 5199, 113, 17852, 116, 17711, 3575, 116, 190, 718, 26405, 28680, 73047, 17852, 116, 17711, 3575, 116, 117, 690, 112, 815, 115, 27798, 111, 109, 602, 127, 432, 40142, 110, 107, 106, 2297, 186, 117, 114, 217, 118, 2794, 769, 233, 15881, 3073, 120, 127, 987, 957, 111, 53582, 110, 108, 111, 237, 1693, 153, 866, 130, 2674, 118, 2794, 769, 233, 15881, 3073, 110, 107, 115, 136, 974, 110, 108, 145, 933, 909, 1574, 124, 109, 769, 233, 15881, 1298, 113, 2712, 17810, 48685, 111, 203, 2274, 111, 109, 5910, 7869, 113, 918, 110, 108, 111, 1693, 153, 866, 130, 2674, 118, 2794, 769, 233, 15881, 3073, 110, 107]}
|
{"text": "aneuploid strains were generated by sporulation of the above polyploid strains , followed by karyotype stability tests and determination as described in fig .\nqpcr assays were designed with primers in non - coding regions on each chromosome arm ( supplementary table 1 lists primer sequences ) .\ndna samples were prepared by alkaline lysis , and qpcr reactions were performed in 384-well plates using a biomek fx ( beckman coulter ) to assemble 10 l reactions and an abi 7900ht ( applied biosystems ) for cycling .\nequal amounts ( od600 ) of aneuploid and euploid control cultures were spotted , using the biomek fx robot , onto omnitrays containing various solid media and grown under conditions listed in supplementary table 2 .\nomnitrays representing three biological replicates of each tested condition were scanned on an hp scanjet 4070 desktop scanner .\nwhole - cell lysates were prepared from 50 ml cycling yeast cultures by bead - beating .\nthe ms / ms datasets were searched using sequest23 against a database of 11,986 sequences , consisting of 5,816 s. cerevisiae non - redundant proteins ( ncbi ) , 177 contaminants and 5,993 decoy sequences .\nall statistical analyses were performed in the r environment25 using standard packages and custom scripts .\naneuploid strains were generated by sporulation of the above polyploid strains , followed by karyotype stability tests and determination as described in fig .\nqpcr assays were designed with primers in non - coding regions on each chromosome arm ( supplementary table 1 lists primer sequences ) .\ndna samples were prepared by alkaline lysis , and qpcr reactions were performed in 384-well plates using a biomek fx ( beckman coulter ) to assemble 10 l reactions and an abi 7900ht ( applied biosystems ) for cycling .\nequal amounts ( od600 ) of aneuploid and euploid control cultures were spotted , using the biomek fx robot , onto omnitrays containing various solid media and grown under conditions listed in supplementary table 2 .\nomnitrays representing three biological replicates of each tested condition were scanned on an hp scanjet 4070 desktop scanner .\nwhole - cell lysates were prepared from 50 ml cycling yeast cultures by bead - beating .\nthe ms / ms datasets were searched using sequest23 against a database of 11,986 sequences , consisting of 5,816 s. cerevisiae non - redundant proteins ( ncbi ) , 177 contaminants and 5,993 decoy sequences .\nall statistical analyses were performed in the r environment25 using standard packages and custom scripts .", "target": " aneuploidy , referring here to genome contents characterized by abnormal numbers of chromosomes , has been associated with developmental defects , cancer , and adaptive evolution in experimental organisms19 . \n however , it remains unresolved how aneuploidy impacts gene expression and whether aneuploidy could directly bring phenotypic variation and improved fitness over that of euploid counterparts . in this work \n , we designed a novel scheme to generate , through random meiotic segregation , 38 stable and fully isogenic aneuploid yeast strains with distinct karyotypes and genome contents between 1n and 3n without involving any genetic selection . through phenotypic \n profiling under various growth conditions or in the presence of a panel of chemotherapeutic or antifungal drugs , we found that aneuploid strains exhibited diverse growth phenotypes , and some aneuploid strains grew better than euploid control strains under conditions suboptimal for the latter . using quantitative mass spectrometry - based proteomics , \n we show that the levels of protein expression largely scale with chromosome copy numbers , following the same trend observed for the transcriptome . \n these results provide strong evidence that aneuploidy directly impacts gene expression at both the transcriptome and proteome levels and can generate significant phenotypic variation that could bring about fitness gains under diverse conditions . \n our findings suggest that the fitness ranking between euploid and aneuploid cells is context- and karyotype - dependent , providing the basis for the notion that aneuploidy can directly underlie phenotypic evolution and cellular adaptation . ", "evaluation_predictions": [2, 145, 731, 114, 17172, 692, 113, 109, 1521, 113, 8517, 75879, 14689, 143, 114, 24103, 75879, 116, 110, 158, 111, 609, 233, 19200, 8731, 143, 38080, 8422, 110, 158, 124, 109, 476, 113, 12244, 115, 612, 233, 2201, 8149, 113, 10839, 110, 940, 2653, 116, 110, 940, 143, 213, 6965, 29579, 6566, 110, 158, 111, 110, 940, 2653, 116, 943, 2653, 116, 110, 940, 143, 28518, 110, 116, 10839, 110, 158, 110, 107, 106, 8517, 75879, 14689, 195, 3943, 141, 110, 37483, 17340, 113, 114, 24103, 75879, 14689, 110, 108, 1734, 141, 32998, 415, 45338, 4528, 2749, 111, 6796, 110, 107, 106, 3294, 3912, 143, 33895, 9725, 110, 158, 113, 114, 24103, 75879, 111, 23198, 75879, 562, 6223, 195, 8666, 110, 108, 303, 109, 56732, 1052, 54060, 8266, 110, 108, 1656, 32615, 47573, 116, 4510, 623, 1907, 636, 111, 2763, 365, 1047, 1661, 115, 27761, 826, 280, 110, 107, 106, 3294, 3912, 143, 33895, 9725, 110, 158, 113, 114, 24103, 75879, 111, 23198, 75879, 562, 6223, 195, 8666, 110, 108, 303, 109, 56732, 1052, 54060, 8266, 110, 108, 1656, 32615, 47573, 116, 4510, 623, 1907, 636, 111, 58382, 365, 1047, 1661, 115, 27761, 826, 280, 110, 107, 106, 9252, 11019, 195, 2303, 124, 24089, 113, 2653, 116, 111, 2653, 116, 943, 2653, 116, 110, 108, 4802, 110, 108, 464, 114, 2367, 113, 7320, 65279, 14012, 111, 114, 2367, 113, 371, 108, 56399, 14012, 110, 107, 110, 106, 2834, 6921, 110, 151, 2834, 10839, 110, 108, 114, 24103, 75879, 14689, 110, 108, 609, 233, 19200, 8731]}
|
{"text": "in order to assess sexual well - being and provide treatment or education for iranian women 's sexuality , it is necessary to understand their sexuality and the meanings they give to sexual behaviors .\nsexual behavior is a complex concept that is difficult to measure . according to webster 's online dictionary , \nthe manner of conducting oneself and sexual simply means whatever relates to sex , the sexes or \nsexual reproduction. thus , sexual behavior would be an act by someone that expresses their sexuality . in the archive for sexology , erwin j. haeberle introduces \nsexual as a word with double meaning , referring to human anatomy as well as to human behavior . he defines sexual behavior as erotic behavior .\ntherefore , in contrast with webster , the critical dictionary in the archive for sexology defines human reproduction as asexual behavior because it concentrates on the biological facts without reference to the erotic feelings of the man and the woman involved .\nthe functional analysis of sexual behaviors has led researchers to develop instruments to gather observable data . in order to change subjective meanings to observable data ,\nthe researchers need to extract meanings from the contexts and populations they seek to measure .\nmany sexually related measures and instruments have been published ; they measure perceptions , attitudes , beliefs and so on . however , the contexts from which the concepts and meanings were extracted to develop these instruments vary .\ndoubtless , their reliability in measuring sexual behaviors as socially constructed , complex and dynamic phenomena can be questioned . in order to determine a research approach for the context of iranian women 's sexuality , review and assessment of existing instruments was essential . after a brief overview of the existing instruments measuring \nnon - risky sexual behaviors among heterosexual women , we look at their cultural appropriateness to measure sexual behaviors within an iranian context .\nfinally , because we find these instruments insufficient , we suggest criteria for cultural - specific sexually related measures in the iranian settings .\nfor the purpose of this paper , we searched literature using medline , pub - med , psychinfo and cinahl from june 2006 to june 2011 .\nthe mesh terms used to search title and abstract included sexuality , sexual behavior , questionnaire and sexual behavior and questionnaire or \nsexually related measure , sexually related tools limited to human , female , english and reproductive age . focused exclusively on the concept of sexual behavior , we screened titles and abstracts . considering that not all abstracts highlighted the specified population and name of the applied tools ,\nthese articles were found in full , and methods sections were reviewed to identify populations and the tools used .\nretrieved articles were included if they used a structured instrument(s ) to measure sexual behaviors of the female population .\nwe excluded those studies whose outcome of interest included risky sexual behaviors or sexual behaviors measured among same sex relationships .\nwe excluded same sex relationships because this form of relationships is illegal and deniable in iran .\nif the original paper was unavailable , we selected the article that used the given tool to measure the study outcomes . in this stage , tools in languages other than english , those employed just for menopausal women and those not related to sexual behaviors were excluded . using gagnon and simon sexual script theory as the theoretical framework ,\ncultural appropriateness ( i.e. understanding and language of sexuality , ethics , and morality ) was our selection criteria for the instruments .\nevaluation of the 143 articles revealed that a majority of them ( 65% ) had utilized the female sexual function index ( fsfi ) in their research .\nthe second most used scale was the pelvic organ prolapsed / urinary incontinence sexual function questionnaire ( pisq-12 ) , utilized in 10.4% of the final articles .\nthe golombok - rust inventory of sexual satisfaction ( griss ) and the arizona sexual experience scale ( asex ) were the next most used instruments by 6.9% and 5.6% of articles , respectively .\nwe reviewed all instruments and determined the subscales as well as measurement types [ table 1 ] .\nwe categorized these instruments into three groups based on their working definitions of sexual behavior and theoretical frameworks .\nthese instruments were reviewed by the authors , who are iranian experts in sexology , reproductive health , and epidemiology .\nof 50 instruments , we found 19 tools applicable in the iranian culture [ table 2 ] .\nthe third group included those which were focused on a specific sexual problem rather than looking at sexual behaviors overall [ table 4 ] .\nthe multidimensional derogatis sexual functioning inventory ( dsfi ) did not fit into any of those three categories . with this overview\n, it appears that there are significant challenges to using these instruments in iranian contexts .\ninstruments features including the subscales compatible scales for iranian culture instruments incompatible with iranian culture problem - focused instruments\ninspiring gagnon and simon 's description of sexual behaviors defined with social scripts , understanding and language of sexuality , ethics , and morality are the main cultural determinants of sexual norms in the iranian society . in her linguistic analysis of sexuality expression of iranian women ,\nmerghati - khoei has revealed the ways of developing terminology and cultural explanations , which are juxtaposed with the exploration of the development of women 's sexuality .\niranian women expressed their sexuality differently from western women even though they understood and talked about the same issues .\nthere is , however , a hesitation when it comes to discussing or reporting the emotional aspects of sexual encounters .\nthe power of culture in dictating daily language for females has been highlighted in morocco as an arab - islamic context .\nsimilarly , culturally meaningful ambiguity in language guides iranian people 's behavior . even though persian vocabulary ,\nconcepts and expressions about sexual matters exist in art , poetry and the beauty of nature , these linguistic resources are not applied in daily life to express sexuality .\nfor example , the sexual attitude scale ( sas ) , certainly a well - designed tool for use within many cultures measures a person 's awareness toward her / his sexual interests and needs as well as sexual - self judgment .\ncommunication of sexual needs or interests with others is another feature of this tool . as a neglected subject matter in the iranian culture , questioning people about their sexual needs and interests or sexual - self concept seems impractical .\nsexuality is an unspoken issue , and individuals might not be linguistically skilled to communicate their sexuality with an interviewer . in sum , the art of using a rich vocabulary of metaphors and euphemisms is a characteristic of iranian speech , used to communicate and encapsulate matters not normally spoken explicitly .\nfor example , for fluent english speakers phrase marital life may indicate all kinds of relationships within a marital framework , while in farsi zendegi - e - zanashoyi ( literally marital life ) has sexual connotations and is usually understood to mean the sexual relationship between husband and wife .\nanother difficulty in asking about sexuality during a study is the struggle between conscious embarrassment and sexual talk . by conscious embarrassment , we mean the shame , prohibition and modesty about sex .\nthe majority of the women who participated in merghati - khoei 's qualitative study pointed out that they were not culturally expected to be straightforward or frank in expressing sexual matters .\nfor example , the sexual desire inventory tends to measure sexual desire as a biologic factor . out of 14 items ,\n4 focus on masturbation and 2 items ask about having interest in casual sex . in iranian contexts ,\nnone of these 6 items would be posed by researchers or responded to by the participants .\nwhy human have sex ? ( ysex ) is another example , which measures number of variables .\nfor instance , some of the items focus on motivations leading people to out - of - wedlock or casual sex .\nalthough casual or extra marital sex happens in every society , questioning iranians about these behaviors is not ethically and religiously possible or feasible .\nthis assertion is based on the common assumptions . in iran , people strongly hold onto the traditional culture of sexuality based on purity ( paki ) ,\n chastity ( nejabat ) , honour ( aberoo ) and honesty ( sedagat ) underlying the family structure .\nthere is also the belief commonly permeating iranian society that people are fairly innocent in terms of sexuality compared with non - muslim or western societies .\nhowever , with these assumptions we can not minimize the impact of factors such as modernization , worldwide communication and cultural transformations in younger generations and the way they learn about sex , practice and develop their sexual understandings . undoubtedly , these factors change behaviors and attitudes .\nsocial conduct and religiosity define the ethical aspect of sexuality in the iranian culture . in iran\nthe teachings of islamic principles tie strongly to shia interpretations , which form the basis for iranians understandings of sexuality .\nthe expression of sexuality is considered legitimate only within the framework of islamic marriage ( nikah ) . moreover , as shown in merghati et al .\nstudy , sexual obedience was seen as the primary goals of the committed muslim woman .\nthe concept of nejabat ( modesty ) is the most important ethical code applied to an iranian woman who is not sexually expressive .\nin contrast , islamic scholar morteza motahari pointed out the islamic clear guidelines toward sexuality , leading neither to any sense of sexual deprivation and frustration , nor to any repressed or inhibited sexual desire .\nhowever , in the islamic doctrine freeing sexual desire and lifting of traditional moral restraints is not accepted . as a criterion ,\nreligiosity has significant effects on iranian women 's sexual understandings ; and that experts working in the fields of gender and sexuality need to be sensitive to the notion that some muslim women may not speak out their sexuality as an indicator of submission to religious codes , of modesty and of being an idealized muslim wife .\nin her linguistic analysis of sexuality expression of iranian women , merghati - khoei has revealed the ways of developing terminology and cultural explanations , which are juxtaposed with the exploration of the development of women 's sexuality .\niranian women expressed their sexuality differently from western women even though they understood and talked about the same issues .\n. there is , however , a hesitation when it comes to discussing or reporting the emotional aspects of sexual encounters .\nthe power of culture in dictating daily language for females has been highlighted in morocco as an arab - islamic context .\neven though persian vocabulary , concepts and expressions about sexual matters exist in art , poetry and the beauty of nature , these linguistic resources are not applied in daily life to express sexuality .\nfor example , the sexual attitude scale ( sas ) , certainly a well - designed tool for use within many cultures measures a person 's awareness toward her / his sexual interests and needs as well as sexual - self judgment .\ncommunication of sexual needs or interests with others is another feature of this tool . as a neglected subject matter in the iranian culture , questioning people about their sexual needs and interests or sexual - self concept seems impractical .\nsexuality is an unspoken issue , and individuals might not be linguistically skilled to communicate their sexuality with an interviewer . in sum , the art of using a rich vocabulary of metaphors and euphemisms is a characteristic of iranian speech , used to communicate and encapsulate matters not normally spoken explicitly .\nfor example , for fluent english speakers phrase marital life may indicate all kinds of relationships within a marital framework , while in farsi zendegi - e - zanashoyi ( literally marital life ) has sexual connotations and is usually understood to mean the sexual relationship between husband and wife .\nanother difficulty in asking about sexuality during a study is the struggle between conscious embarrassment and sexual talk . by conscious embarrassment , we mean the shame , prohibition and modesty about sex .\nthe majority of the women who participated in merghati - khoei 's qualitative study pointed out that they were not culturally expected to be straightforward or frank in expressing sexual matters .\nfor example , the sexual desire inventory tends to measure sexual desire as a biologic factor . out of 14 items ,\n4 focus on masturbation and 2 items ask about having interest in casual sex . in iranian contexts ,\nnone of these 6 items would be posed by researchers or responded to by the participants .\nfor instance , some of the items focus on motivations leading people to out - of - wedlock or casual sex .\nalthough casual or extra marital sex happens in every society , questioning iranians about these behaviors is not ethically and religiously possible or feasible .\nthis assertion is based on the common assumptions . in iran , people strongly hold onto the traditional culture of sexuality based on purity ( paki ) , chastity ( nejabat ) , honour ( aberoo ) and honesty ( sedagat ) underlying the family structure .\nthere is also the belief commonly permeating iranian society that people are fairly innocent in terms of sexuality compared with non - muslim or western societies .\nhowever , with these assumptions we can not minimize the impact of factors such as modernization , worldwide communication and cultural transformations in younger generations and the way they learn about sex , practice and develop their sexual understandings .\nundoubtedly , these factors change behaviors and attitudes . social conduct and religiosity define the ethical aspect of sexuality in the iranian culture .\nin iran the teachings of islamic principles tie strongly to shia interpretations , which form the basis for iranians understandings of sexuality .\nthe expression of sexuality is considered legitimate only within the framework of islamic marriage ( nikah ) . moreover , as shown in merghati et al .\nstudy , sexual obedience was seen as the primary goals of the committed muslim woman .\nthe concept of nejabat ( modesty ) is the most important ethical code applied to an iranian woman who is not sexually expressive .\nin contrast , islamic scholar morteza motahari pointed out the islamic clear guidelines toward sexuality , leading neither to any sense of sexual deprivation and frustration , nor to any repressed or inhibited sexual desire .\nhowever , in the islamic doctrine freeing sexual desire and lifting of traditional moral restraints is not accepted . as a criterion ,\nreligiosity has significant effects on iranian women 's sexual understandings ; and that experts working in the fields of gender and sexuality need to be sensitive to the notion that some muslim women may not speak out their sexuality as an indicator of submission to religious codes , of modesty and of being an idealized muslim wife .\nto investigate sexual behaviors in an iranian context , we recognize the importance of identifying or developing an instrument to assess sexual behavior domains among women in the particular context of iranian culture .\nwe thought that such an instrument would be essential tool for achieving a more systematic and in - depth understanding of iranian women 's sexuality , may be useful in applied settings , and would advance sexuality research as a whole . no matter the context or use\n, however , measuring a construct such as sexual behavior is subjective and therefore entirely dependent on self - report .\nit has been argued that iranian women may not report properly if they believe sexuality has nothing to do with health .\nfor example , a woman 's inability to gain sexual pleasure due to painful intercourse might not be defined as a sexual health problem to be reported , whereas other people would consider it as a sexual health problem for the woman .\nthis suggests the idea that the culture of sexuality affects people 's interpretations of sexually related problems .\ndeveloping a contextualized instrument to measure the domains of sexual behavior would allow sexuality and gender researchers to better answer questions related to the influence of culture in those domains , sexual scripts across diverse cultures , and other factors influencing sexual health outcomes . in the 1970s , gagnon and simon 's sexual conduct represented the first truly sociological analysis of sexual behavior .\ngagnon and simon defined sexual behavior within a new theoretical framework of social scripts. they produced a critique that moved us beyond the objective definition of sexual behavior : our concern here is to understand sexual activities of all kinds as the outcome of a complex psychological process of development , and it is only because they are embedded in social scripts that the physical acts themselves become possible it is neither fixed by nature or by the organs themselves .\nthe very experience of sexual excitement that seems to originate from hidden internal sources is in fact a learned process and it is only our insistence on the myth of naturalness that hides these social components from us . the \ncharacter through a cultural scenario in which they take up , internalize and enact culturally prescribed normative roles ; interpersonal scripts in which they make a suitable identity based on desired expectations and intrapsychic scripting in which they make the self in relation to social life .\nthus , sexual practice is separated from the biology of the body and one 's sexuality is strongly formed by the very complex social world .\nhaving investigated the history of human sexuality , we believe sexuality is influenced by the society , culture and era in which people live . within an iranian context , we therefore recognized existing instruments targeting \nnon - risky sexual behaviors among heterosexual women are insufficient to measure sexual behaviors .\nwe categorized instruments as culturally compatible or incompatible based on the sexuality domains they tend to measure .\nthe instruments , by which the biological aspects of sexual behaviors are measured were found applicable for any given community or population , the iranian context included .\nalternatively , those measuring outcomes related to subjects attitudes , understanding or sexual scripts were identified as culturally incompatible .\nmost of the tools seem reasonable candidates for use in the iranian culture and society with minor revisions [ table 1 ] .\nreview of these instruments shows that most of them are functional based , such as the most used scale in literature , ( fsfi ) .\nother well known tools , such as the arizona sexual experience scale ( asex ) and the golombok - rust inventory of sexual satisfaction ( griss ) , are also functional based .\nsome other tools are problem - focused [ table 3 ] and specific to measure only disorder - based outcomes .\nwe argue that the medically oriented instruments employed in the field are drawn from concepts and meanings based on investigations conducted in western societies .\nyet as researchers , we sometimes found ourselves disappointed by the level of difficulty , which we professionals encountered in fitting our participants into those biomedical frameworks .\nthe culture - bound nature of sexuality limits the research - based information in iran . in our society\n, the lack of information in the sexual domain will be most productively addressed first through research attention to subjective concepts .\nlack of sufficient knowledge in the field of sexuality in iranian contexts , makes it important to identify normative sexual behaviors qualitatively before applying problem - oriented tools in research .\nthere are social and cultural challenges arising from the recognition that iranians use culturally specific sexual expressions .\nthese expressions may construct different ways of perceiving sexuality that are not easily translatable or even understandable by outsiders .\nthis means that sexuality is a complex phenomenon embedded in various meanings and understandings , not merely objective and measurable behavior . explaining those meanings and perceptions makes sexuality a dynamic phenomenon through one 's life time . how we know what we know changes periodically and therefore , creating an epistemological crisis in knowledge as well as the research process .\nhowever , scholars in science and human behavior such as skinner have powerfully questioned the reliability of subjective measures of private events such as sexual behaviors .\nwe concluded that the published instruments are well - designed and used worldwide ; however , we must also acknowledge that the sexual scripts of iranian women define sexual behaviors differently , limiting their communication in the research setting and compromising the compatibility of these instruments .\ntherefore , exploring and analyzing the lexicon and expressions used by the iranian women creates a ground for developing a culturally comprehensive measure , which can adequately examine how these women explain their sexual behaviors .", "target": " the cultural compatibility of sexually related instruments is problematic because the contexts from which the concepts and meanings were extracted may be significantly different from related contexts in a different society . \n this paper describes the instruments that have been used to assess sexual behaviors , primarily in western contexts . \n then , based on the instruments working definition of sexual behavior and their theoretical frameworks , we will ( 1 ) discuss the applicability or cultural compatibility of existing instruments targeting women 's sexual behaviors within an iranian context , and ( 2 ) suggest criteria for sexually related tools applicable in iranian settings . \n iranian women 's sexual scripts may compromise the existing instruments compatibility . \n suggested criteria are as follows : understanding , language of sexuality , ethics and morality . \n therefore , developing a culturally comprehensive measure that can adequately examine iranian women 's sexual behaviors is needed . ", "evaluation_predictions": [2, 115, 385, 112, 4676, 5547, 210, 233, 270, 111, 319, 791, 132, 798, 118, 110, 35057, 3262, 652, 110, 108, 126, 117, 993, 112, 630, 111, 112, 361, 2050, 112, 153, 5547, 8484, 110, 107, 115, 385, 112, 411, 17121, 18683, 112, 42808, 335, 110, 108, 109, 2995, 217, 112, 5703, 18683, 135, 109, 16464, 111, 8149, 157, 2395, 112, 2488, 110, 107, 802, 110, 108, 153, 5603, 115, 6542, 5547, 8484, 130, 12311, 4886, 110, 108, 1482, 111, 3248, 16327, 137, 129, 12689, 110, 107, 115, 136, 692, 110, 108, 145, 933, 111, 4676, 109, 1385, 4849, 6542, 609, 233, 12819, 5547, 8484, 790, 110, 65126, 652, 110, 108, 153, 2345, 59155, 112, 2488, 5547, 8484, 373, 142, 110, 35057, 3262, 2956, 110, 108, 111, 145, 2298, 4249, 118, 2345, 233, 739, 23137, 985, 2548, 115, 109, 110, 35057, 3262, 2499, 110, 107, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]}
|
{"text": "a level of pain that completely incapacitates one individual may cause only a minor annoyance in another .\ncharacterizing the genetic factors affecting susceptibility to chronic pain could lead to novel treatment or prevention strategies , which are desperately needed . a recent paper by costigan et al . \nthe authors performed a multi - dimensional analysis using rat gene expression and human genetic association that identified a new genetic factor affecting susceptibility to chronic pain .\nthis study was initiated by analysis of gene expression changes within rat dorsal root ganglia obtained after nerve damage was induced in three different models of chronic pain .\nthe mrna for a potassium channel alpha subunit ( kcns1 ) was constitutively expressed in sensory neurons , but was downregulated after three types of nerve injury in these models .\nother studies have successfully identified a human genetic susceptibility factor on the basis of a candidate gene emerging from analysis of a rodent model .\ncostigan and colleagues therefore examined snp alleles within the human homolog ( kcns1 ) in five independent cohorts ( two with chronic low back pain , two after limb amputation and one after mastectomy ) that have a high incidence of chronic pain . in four of\nthe five cohorts studied , there was a significant association of the val allele at a nonsynonymous snp ( rs734784 , val / ile ) with increased risk for chronic pain .\nfor example , homozygous val / val individuals had a 2.4-fold increased relative risk of failing to achieve pain improvement 1 year after back surgery .\nthe proportion of individuals without phantom limb pain after leg amputation was 45% in those without the val allele , but fell to 22% in val / val homozygotes . among healthy volunteers that were subjected to multiple experimental pain stimuli ,\nalthough experimental studies demonstrating an allelic effect were not presented , which is a substantial limitation of this study , these results make it likely that kcns1 alleles contribute to susceptibility to chronic pain .\nalthough kcns1 by itself does not have potassium channel function when tested in heterologous expression systems , its expression has been shown to modulate the currents formed by other channels [ 3 - 5 ] .\nvoltage - gated potassium channels have important effects on neuronal function , including altering the resting membrane potential and the shape and frequency of the action potential\n. similarly , gain - of - function mutations in the nav1.7 sodium channel cause syndromes associated with increased pain sensitivity .\nchronic pain has a huge impact on our society , and its treatment is a major driver for the increasing cost of health care . an estimated 76 million people in the us have chronic pain , which costs the us public over $ 100 billion per year .\napproximately 25% of chronic pain is neuropathic ( caused by nerve damage ) , which is characterized by spontaneous pain that is burning or stabbing in nature .\nthis can develop after limb amputation , mastectomy or lower back injury , or in individuals with a long history of diabetes .\nalthough multiple kinds of treatment can be used , they often have limited efficacy , and chronic pain is often managed by administration of opioids ( morphine and related synthetic compounds , including hydrocodone ) .\nthe increased focus on pain management resulted in a six - fold increase in the per capita sales of prescription opioid medications in the us between 1997 and 2006 .\nhydrocodone - acetaminophen is prescribed over 100 million times per year in the us , which is far more than any other medication , including lipid - lowering and blood - pressure - lowering agents .\nthis has led to a dramatic increase in the incidence of opioid misuse , emergency room visits due to opioid analgesic poisoning , and fatal opioid overdose .\nprescription opioids have now surpassed marijuana as the drug that is most commonly abused among the newly initiated .\nbecause of the enormity of this public health problem , we desperately need new approaches for the prevention or treatment of chronic pain conditions .\nit is likely that genetic discoveries can lead to new approaches for chronic pain , because genetic discoveries have catalyzed new approaches for related clinical conditions .\nfor example , haplotype - based computational genetic analysis has identified causative genetic factors affecting analgesic medication and inflammatory pain responses , and it has identified four genes affecting narcotic drug responses [ 11,14 - 16 ] in mice .\nthe latter genetic discovery generated a new treatment strategy for preventing narcotic drug withdrawal symptoms , which was shown to be effective in humans .\nmoreover , the variable response to multiple classes of analgesic medications among inbred mouse strains was shown to be due to genetic variation within a genetic locus ( kcnj9 ) that also encodes a potassium channel ( girk3 ) .\nhopefully , characterizing the functional role of kcns1 in neuronal responses and pain perception , and the impact of the allelic differences , could lead to new approaches for treatment of chronic pain .\nalthough the tractability of kcns1 ( or other potassium channels ) as a therapeutic target remains to be determined , small molecules targeting potassium channels have been produced ( reviewed in ) , and one has attenuated neuropathic pain in animal models . although the kcns1 val allele explains only a small percentage of the total variance ( 4.6 to 7.8% ) in the chronic pain endpoints in the cohorts studied , the identification of an initial genetic factor for chronic pain is an important achievement for two reasons .\nfirst , it shows that genetic factors can be identified for this condition , and this study provides a template for subsequent studies .\nsecond , it is likely that a greater percentage of the genetic susceptibility to chronic pain can be explained by combining this genetic factor with other subsequently identified factors .\nmoreover , pain is a subjective sensory symptom ; it is difficult to measure ; and there are substantial psychological and emotional components that contribute to the perception of pain .\nit has recently been found that there are different subtypes of chronic pain , which are distinct from the causative disease ( diabetic neuropathy , radicular back pain and so on ) .\nit is likely that genetic factors determine whether a chronic pain syndrome will develop and the specific subtype that emerges after exposure to a triggering cause .\nthus , the impact of a single genetic factor could be much larger if a specific pain subtype is examined relative to that measured in a large cohort of individuals with different types of chronic pain .\nbeyond finding new drug targets , identification of genetic factors affecting susceptibility to chronic pain syndromes could be the lever that drives advances in this difficult clinical area .\na genetic risk factor could have a substantial impact on clinical practice because individuals at increased risk for developing a chronic pain syndrome could be identified before a surgical procedure or immediately after a traumatic incident . the genetic information could be used to develop proactive methods for prevention of chronic pain syndromes , enabling interventions to be targeted to the high - risk subset . because of the great inter - individual variation in the response to painful stimuli and to analgesic drugs , knowledge of genetic risk factors could enable better stratification of chronic pain patients or aid in the selection of the appropriate therapy . rather than focusing on the disease that is etiologically associated with the chronic pain ,\nstudy is hopefully one of the first of many subsequent genetic studies that could lead to entirely new ways to approach chronic pain syndromes .\nclearly , the clinical and research communities have a long way to go before genetically targeted therapies for chronic pain become a reality .\nhowever , kcns1 ( or other channels ) could perhaps become the next target for a new class of analgesics that are selectively used in the 20% of the population that are homozygous for the val alleles of kcns1 .\nthe day might soon come when we no longer think of ' chronic pain ' as a single clinical entity , but have the tools to characterize the specific ' channelopathy ' that underlies the clinical presentation and targeted treatments for each subgroup .\ngp is a professor and mz is the director of statistical research in the department of anesthesia at stanford university medical school .", "target": " a recent publication that combined rat gene expression data and a human genetic association study has identified the first genetic risk factor for chronic pain in humans . in four of \n the five cohorts studied , there was a significant association of an allele within a gene ( kcns1 ) encoding a potassium channel ( kv9.1 ) with an increased risk for chronic pain . \n identification of genetic risk factors for chronic pain could catalyze new advances in this difficult clinical area that has become a major public health problem . \n genomic - medicine - based advances for chronic pain could include the development of a mechanism - based classification system for chronic pain , new treatment options , improved methods for treatment selection and targeted prevention strategies for high - risk individuals . ", "evaluation_predictions": [2, 938, 110, 108, 114, 1546, 233, 19125, 1382, 303, 16579, 7365, 3980, 111, 883, 6761, 4097, 3087, 114, 177, 6761, 2634, 7271, 41354, 112, 4906, 1246, 110, 107, 106, 136, 692, 140, 9891, 141, 1382, 113, 7365, 3980, 852, 373, 16579, 52394, 3614, 95709, 3686, 244, 8165, 1303, 140, 16399, 115, 339, 291, 1581, 113, 4906, 1246, 110, 107, 106, 136, 692, 5994, 120, 4817, 22731, 116, 740, 149, 12078, 116, 3222, 112, 41354, 112, 4906, 1246, 110, 108, 162, 493, 126, 770, 120, 4817, 22731, 116, 740, 149, 12078, 116, 3222, 112, 109, 7439, 113, 4906, 1246, 111, 109, 979, 113, 136, 7439, 112, 109, 281, 233, 887, 22325, 110, 107, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]}
|
{"text": "optical coherence tomography ( oct ) is a noninvasive method that evaluates biological tissues by in vivo imaging.1 since its introduction , oct has undergone several improvements and revolutionized the diagnostic , monitoring , and therapeutic approaches to many retinal diseases and glaucoma .\ncomputerized algorithms can be used on the high - resolution images obtained by modern oct devices in order to identify and measure the thicknesses of discrete retinal layers , including the retinal nerve fiber layer ( rnfl ) , macular ganglion cell complex ( gcc ) , and choroid.2,3 the choroid is the most vascular tissue in the eye and is known to have an important role in ocular nutrition , volume regulation , and temperature control.4 choroidal abnormalities are critical to the onset and progression of many chorioretinal disorders such as age - related macular degeneration ( amd ) , polypoidal choroidal vasculopathy , vogt - kayanagi - harada disease , and central serous chorioretinopathy.5 with the recent development of enhanced depth imaging ( edi ) , in vivo assessment of the choroid has become an area of interest .\nedi allows better visualization and quantitative evaluation of the choroid , which was not possible before .\ninformation about the choroidal thickness ( ct ) is useful in many clinical situations for decision making regarding the management and monitoring of disease progression.6 neurodegenerative diseases such as glaucoma preferentially affect the gcc , which is the sum of the three innermost layers : the rnfl , the retinal ganglion cell layer , and the inner plexiform layer .\nthese contain the axons , cell bodies , and the dendrites of the retinal ganglion cells , respectively.7,8 recent studies have shown that measurement of macular gcc thickness has the same diagnostic potential for glaucoma as rnfl thickness.911 moreover , it has been reported that measurements of average gcc thickness had better sensitivity in detecting changes in retinal thickness in multiple sclerosis neurodegeneration than rnfl thickness measured by oct.12 both ct and gcc thickness measurements can be affected by several factors such as pupil size , scan quality , and cataract . in this study\n, we aimed to evaluate the effect of uneventful cataract surgery on subfoveal ct and gcc thickness measured by edi - oct .\nthis prospective study included consecutive patients who had undergone uneventful phacoemulsification surgery for senile cataract at sakarya university medical education and research hospital between november 2013 and june 2015 .\nthe present study was approved by the institutional review board of sakarya university medical education and research hospital and adhered to the tenets of the declaration of helsinki and all patients signed informed consent after they received an explanation of the nature and possible consequences of the procedure .\nexclusion criteria included a history of prior ocular surgery and systemic / ocular diseases such as diabetes mellitus , hypertension , glaucoma , amd , diabetic retinopathy , retinal vein occlusion , uveitis , or other inflammatory and vascular pathologies .\npatients with unstable fixation or dense cataracts leading to a poor scan quality of oct images and eyes with increase in postoperative intraocular pressure ( iop ) or cystoid macular edema were also excluded .\nall patients had a full ophthalmic examination , including best - corrected visual acuity ( bcva ) assessment , as well as slit - lamp biomicroscopy and dilated fundoscopy evaluation , and iop measurement by goldmann applanation tonometry .\naxial length ( al ) was measured by immersion echography ( axis ii ; quantel medical inc . , cedex , france ) and central corneal thickness ( cct ) was measured by ultrasonographic pachymetry ( pacline ; optikon 2000 spa , rome , italy ) .\nprior to the operation , tropicamide 1% and phenylephrine hydrochloride 2.5% were applied to patients eyes for pupil dilation .\nphacoemulsification was performed by one experienced surgeon ( ec ) using infiniti vision system ( alcon laboratories , inc . ) . a clear corneal incision of 2.8 mm , 600 mmhg vacuum , an aspiration flow rate of 30 ml / min , bottle height of 75 cm , and quick - chop technique were used in all surgeries .\ntwo different dispersive viscoelastics ( viscoat and bivisc ) and two different cohesive viscoelastics ( healon and bio - hyalur ) were used during cataract surgery .\none - piece hydrophobic acrylic intraocular lens ( sensar model : aab00 ; abbott medical optics inc . , santa ana , ca , usa ) was used in all surgeries .\nviscoelastics were cleaned out with marked attention , even behind the intraocular lenses . the procedure ended with intracameral cefuroxime axetil 1 mg/0.1 ml for prophylaxis for endophthalmitis .\nthe operative times ( ots ) and effective phaco times ( epts ) were recorded in each case .\npostoperatively , all patients were treated with topical antibiotics ( ofloxacin 0.3% ) for 1 week and topical steroid drops ( prednisolone acetate 1% ) for 4 weeks .\ncirrus edi - oct ( carl zeiss meditec ag , jena , germany ; software version 6.5.0.772 ) was used to obtain subfoveal ct and gcc thickness measurements using high - definition one - line raster and ganglion cell analysis ( macular cube 512128 ) scan protocols , respectively .\nscans with misalignment , segmentation failure , decentration of the measurement circle , and poor illumination , or those out of focus , were also excluded .\nthe one - line raster is a 6 mm line consisting of 4,096 a - scans .\nscan 3 of the five scans taken , which passes through the fovea , was used for all measurements .\nct was defined as the vertical distance from the outer portion of the hyperreflective line corresponding to bruch s membrane beneath the retinal pigment epithelium to the outermost hyperreflective line of the inner scleral border . to avoid the effects of mydriatic agents or diurnal changes ,\nthe ct was measured from the subfoveal region by using the cirrus linear measurement tool .\nwhen there was a discrepancy of > 10% of the mean of the two values between the observers in two eyes in the study , observers discussed and repeated the measurements , and the average results from the two observers were determined as the final ct readings .\nthe cirrus oct device allows a quantitative assessment of the ganglion cell and inner plexiform layers ( gcipl ) in six circular sectors centered in the fovea .\nit also gives information on the mean and minimum gcipl thickness for each eye and compares these figures with a normative database .\nmacular cube 512128 acquisition protocol generates a cube through a 6 mm square grid of 128 b - scans , each composed of 512 a - scans .\na built - in gcipl analysis algorithm detects and measures the thickness of the macular gcipl within a 662 mm elliptical annulus area centered on the fovea .\nthe annulus has an inner vertical diameter of 1 mm , which was chosen to exclude the portions of the fovea where the layers are very thin and difficult to detect accurately , and an outer vertical diameter of 4 mm , which was chosen according to where the ganglion cell layer again becomes thin and difficult to detect .\nthe ganglion cell analysis algorithm identifies the outer boundaries of the rnfl and the inner plexiform layer .\nthe difference between the rnfl and the inner plexiform layer outer boundary segmentations yields the combined thickness of the retinal gcipl .\nsimilar to other cirrus printouts , it provides gcipl measurements in six wedge - shaped sectors with a pseudocolor scheme .\nthose that are abnormal at the < 5% and at the < 1% level are represented by yellow and red backgrounds , respectively .\nthe primary objective of this study was to evaluate the subfoveal ct and average gcc thickness changes ; however , central macular thickness ( cmt ) and peripapillary rnfl thickness were also obtained by the macular cube 512128 and optic disc cube 200200 protocols , respectively , using the cirrus oct device .\nstatistical analysis was performed using spss statistics for windows , version 20.0 ( ibm corporation 2011 , armonk , ny , usa ) .\npaired - samples t - test was used for equality of means , and analysis of variance regression and pearson correlation analysis were used for correlations between parameters .\nthis prospective study included consecutive patients who had undergone uneventful phacoemulsification surgery for senile cataract at sakarya university medical education and research hospital between november 2013 and june 2015 .\nthe present study was approved by the institutional review board of sakarya university medical education and research hospital and adhered to the tenets of the declaration of helsinki and all patients signed informed consent after they received an explanation of the nature and possible consequences of the procedure .\nexclusion criteria included a history of prior ocular surgery and systemic / ocular diseases such as diabetes mellitus , hypertension , glaucoma , amd , diabetic retinopathy , retinal vein occlusion , uveitis , or other inflammatory and vascular pathologies .\npatients with unstable fixation or dense cataracts leading to a poor scan quality of oct images and eyes with increase in postoperative intraocular pressure ( iop ) or cystoid macular edema were also excluded .\nall patients had a full ophthalmic examination , including best - corrected visual acuity ( bcva ) assessment , as well as slit - lamp biomicroscopy and dilated fundoscopy evaluation , and iop measurement by goldmann applanation tonometry .\naxial length ( al ) was measured by immersion echography ( axis ii ; quantel medical inc . , cedex , france ) and central corneal thickness ( cct ) was measured by ultrasonographic pachymetry ( pacline ; optikon 2000 spa , rome , italy ) .\nprior to the operation , tropicamide 1% and phenylephrine hydrochloride 2.5% were applied to patients eyes for pupil dilation .\nphacoemulsification was performed by one experienced surgeon ( ec ) using infiniti vision system ( alcon laboratories , inc . ) . a clear corneal incision of 2.8 mm , 600 mmhg vacuum , an aspiration flow rate of 30 ml / min , bottle height of 75 cm , and quick - chop technique were used in all surgeries .\ntwo different dispersive viscoelastics ( viscoat and bivisc ) and two different cohesive viscoelastics ( healon and bio - hyalur ) were used during cataract surgery .\none - piece hydrophobic acrylic intraocular lens ( sensar model : aab00 ; abbott medical optics inc . , santa ana , ca , usa ) was used in all surgeries .\nviscoelastics were cleaned out with marked attention , even behind the intraocular lenses . the procedure ended with intracameral cefuroxime axetil 1 mg/0.1 ml for prophylaxis for endophthalmitis .\nthe operative times ( ots ) and effective phaco times ( epts ) were recorded in each case .\npostoperatively , all patients were treated with topical antibiotics ( ofloxacin 0.3% ) for 1 week and topical steroid drops ( prednisolone acetate 1% ) for 4 weeks .\ncirrus edi - oct ( carl zeiss meditec ag , jena , germany ; software version 6.5.0.772 ) was used to obtain subfoveal ct and gcc thickness measurements using high - definition one - line raster and ganglion cell analysis ( macular cube 512128 ) scan protocols , respectively .\nscans with misalignment , segmentation failure , decentration of the measurement circle , and poor illumination , or those out of focus , were also excluded .\nthe one - line raster is a 6 mm line consisting of 4,096 a - scans .\nscan 3 of the five scans taken , which passes through the fovea , was used for all measurements .\nct was defined as the vertical distance from the outer portion of the hyperreflective line corresponding to bruch s membrane beneath the retinal pigment epithelium to the outermost hyperreflective line of the inner scleral border . to avoid the effects of mydriatic agents or diurnal changes ,\nthe ct was measured from the subfoveal region by using the cirrus linear measurement tool . when there was a discrepancy of > 10% of the mean of the two values between the observers in two eyes in the study , observers discussed and repeated the measurements , and the average results from the two observers\nthe cirrus oct device allows a quantitative assessment of the ganglion cell and inner plexiform layers ( gcipl ) in six circular sectors centered in the fovea\n. it also gives information on the mean and minimum gcipl thickness for each eye and compares these figures with a normative database .\nmacular cube 512128 acquisition protocol generates a cube through a 6 mm square grid of 128 b - scans , each composed of 512 a - scans .\na built - in gcipl analysis algorithm detects and measures the thickness of the macular gcipl within a 662 mm elliptical annulus area centered on the fovea .\nthe annulus has an inner vertical diameter of 1 mm , which was chosen to exclude the portions of the fovea where the layers are very thin and difficult to detect accurately , and an outer vertical diameter of 4 mm , which was chosen according to where the ganglion cell layer again becomes thin and difficult to detect .\nthe ganglion cell analysis algorithm identifies the outer boundaries of the rnfl and the inner plexiform layer .\nthe difference between the rnfl and the inner plexiform layer outer boundary segmentations yields the combined thickness of the retinal gcipl .\nsimilar to other cirrus printouts , it provides gcipl measurements in six wedge - shaped sectors with a pseudocolor scheme .\nthose that are abnormal at the < 5% and at the < 1% level are represented by yellow and red backgrounds , respectively .\nthe primary objective of this study was to evaluate the subfoveal ct and average gcc thickness changes ; however , central macular thickness ( cmt ) and peripapillary rnfl thickness were also obtained by the macular cube 512128 and optic disc cube 200200 protocols , respectively , using the cirrus oct device .\nstatistical analysis was performed using spss statistics for windows , version 20.0 ( ibm corporation 2011 , armonk , ny , usa ) .\npaired - samples t - test was used for equality of means , and analysis of variance regression and pearson correlation analysis were used for correlations between parameters .\na total of 30 eyes of 30 patients ( 16 male and 14 female ) , with a mean age of 60.24.2 years were included in this study .\nmean bcva improved in all eyes , and this improvement was statistically significant ( 0.460.15 logarithm of minimum angle of resolution [ logmar ] units preoperatively and 0.060.49 logmar units postoperatively ; p<0.001 ) .\nmean preoperative al was 22.80.6 mm ( range : 21.524.1 mm ) and mean cct was 551.522.1 m .\nmean ot was 8.62.7 minutes and mean ept was 6.92.5 seconds ( table 1 ) .\nthe mean subfoveal ct was 294.439.2 m ( range : 201356 m ) preoperatively and 301.439.9 m ( range : 231367 m ) postoperatively .\nthe mean gcc thickness was 85.04.4 m ( range : 7894 m ) preoperatively and 89.25.3 m ( range : 8199 m ) postoperatively .\nthe mean cmt was 247.917.6 m preoperatively ( range : 211280 m ) and 249.017.8 m ( range : 213278 m ) postoperatively .\nthe mean rnfl thickness was 97.45.4 m preoperatively ( range : 87110 m ) and 101.75.6 m ( range : 91113 m ) postoperatively .\nregression analysis showed that age , sex , al , cct , ot , and ept were not associated with ct changes ( p=0.834 , p=0.129 , p=0.203 , p=0.343 , p=0.547 , and p=0.147 , respectively ) and gcc thickness changes ( p=0.645 , p=0.542 , p=0.152 , p=0.664 , p=0.448 , p=0.268 , respectively ) after cataract surgery .\nin this study , we investigated the effect of cataract surgery on subfoveal ct and gcc thickness , as measured by edi - oct , and we found that both subfoveal ct and gcc thickness increased slightly after cataract surgery .\ncmt and peripapillary rnfl thicknesses were also evaluated as a secondary objective , and we observed statistically significant increases in cmt and rnfl thickness .\nour results indicate that cmt , subfoveal ct , as well as rnfl and gcc thicknesses are slightly affected after phacoemulsification surgery .\nalthough our study included a small group ( only 30 eyes ) , we assume that our data reliability is high because of the homogeneous nature of the patients ( similarities of age , cataract type and severity , cct , al , ot , ept and so on ) and the careful / detailed oct examinations performed by two observers , avoiding the effects of diurnal changes and mydriatic agents .\nzhao et al13 revealed significant diurnal variations of the ct at the macular region in young healthy female individuals .\ncataract surgery by phacoemulsification is one of the most common intraocular surgeries that improve the quality of vision .\nhowever , it is an invasive procedure leading to an inflammatory response mostly induced by the release of prostaglandins in the retina and choroid and , in many patients , can lead to worsening of preexisting retinal diseases such as diabetic macular edema.15,16 recent studies have shown subclinical increase of cmt and peripapillary rnfl thickness after uneventful cataract surgery.1719 however , the morphologic changes that this inflammatory insult produces in the choroid have not been studied well because of the lack of detailed imaging techniques for the choroid .\nafter the introduction of edi , changes in ct in several pathologic ( central serous chorioretinopathy , choroidal neovascularization , and high myopia ) and physiologic ( age , sex , and al ) conditions can be easily assessed.2022 therefore , ct is being measured increasingly often and is becoming an accepted procedure for clinical and research applications .\nfalco et al23 evaluated the effect of uneventful phacoemulsification on the subfoveal ct and cmt , and they reported that phacoemulsification induced nonpathologic increases in cmt ; however , these changes were not accompanied by significant changes in ct .\nthey claimed that the inflammatory insult due to phacoemulsification mainly affects at the retinal level and seems to be independent of ct changes.23 by contrast ; our results support the recent studies by ohsugi et al24 and noda et al,25 which report significant increases in ct after uneventful phacoemulsification .\nohsugi et al24 evaluated 100 eyes and emphasized that the al and changes in iop were critical for evaluating the changes in ct after cataract surgery .\nnoda et al25 evaluated 29 eyes and observed that the increase in subfoveal ct did not subside to baseline even at 6 months postoperatively .\nthey also found that male sex and thicker baseline ct predicted a larger magnitude of increase in ct after cataract surgery.25 in our study , interestingly , the parameters of age , sex , al , baseline ct , and cct did not influence the postoperative ct statistically in regression analysis .\nwe also analyzed the effect of ot and ept on postoperative ct and we did not find any relationship .\nthis may be explained by the short / similar results in terms of ots and epts , as well as the experience of the surgeon conducting a quick surgery with less anterior segment manipulation , thus reducing the inflammatory response after cataract surgery .\na speculation is that it may be related to postoperative inflammation because proinflammatory prostaglandins and cytokines are considered to explain macular edema after cataract surgery , and inflammatory disorders are also known to increase the ct.26,27 another speculation is that cataract surgery introduces more light into the eyes , leading to greater metabolic activation in the retinal pigment epithelium , causing angiogenesis and inflammation.28,29 in the beaver dam and blue mountains eye studies,3032 it has been suggested that cataract surgery is associated with the onset of amd , resulting in visual impairment due to neovascularization originating from the choroid .\nnoda et al25 report that cataract surgery influences the ct and this influence persists for as long as 6 months postoperatively and may affect the process of amd .\nchoroidal abnormalities are central to chorioretinal disorders such as amd , polypoidal choroidal vasculopathy , and central serous chorioretinopathy .\nfurthermore , it has been claimed that pathologic choroidal blood supply is an important factor in open - angle glaucoma leading to optic nerve damage.33,34 cts of glaucomatous eyes have been reported to be thinner in postmortem histologic studies .\nin addition , significant increases in choroidal extravascular volume have been confirmed in many primary angle - closure glaucoma eyes and abnormal ct has been hypothesized to be a contributing feature in these eyes.35,36 however , it is unclear whether these findings represent a risk factor or a consequence of these diseases .\nthe hallmark of glaucoma is the loss of the retinal ganglion cell axons , which leads to a typical optic neuropathy .\nqualitative and quantitative evaluations of the optic nerve head and rnfl have been used to detect evidence of glaucomatous damage.911 in a recent study,8 it has been suggested that the gcc thickness may be the most relevant parameter to measure in glaucoma .\nnouri - mahdavi et al37 also reported that regional gcc measurements derived from cirrus hd - oct performed as well as regional rnfl outcomes for the detection of early glaucoma .\nmoreover , macular gcc thickness has been found to have better structure function correlations than rnfl thickness with both visual function and central nervous system findings in multiple sclerosis neurodegeneration.12 as oct uses near - infrared light and is based on interferometry , its image quality is influenced by opacities in the optical path .\nloss of oct image quality is caused by attenuation of the light in the oct scanning spot on the retina.17,18 several studies have shown that lens opacity decreased image quality and postoperative rnfl thickness measurements increased significantly.3840 the more advanced the cataract , the less is the signal quality and the thinner are the recorded rnfl and gcc thicknesses .\nthe coexistence of neurodegenerative diseases such as glaucoma and cataract among elderly patients is not unusual , and cataract may decrease the quality of fundus images , leading to an incorrect evaluation in the diagnosis and follow - up of these patients .\nnakatani et al7 examined the effect of cataract on the measurements of gcc and rnfl thicknesses , and they reported that all thickness parameters in gcc and rnfl increased slightly after phacoemulsification surgery .\ntherefore , we decided that the presence of cataract may lead to an underestimation of the thicknesses of gcc and rnfl , and this should be taken into account when analyzing progression in glaucoma and/or neurodegenerative diseases such as multiple sclerosis .\nafter cataract surgery , the examiners should consider obtaining new baseline measurements , as suggested in previous studies .\nthis study has many limitations such as short follow - up time , relatively small sample size , and lack of eyes with glaucoma and neurodegenerative diseases .\nin addition , we analyzed just mean subfoveal ct and mean thickness of gcc and rnfl , leading to lack of segmentation of these parameters .\nscleral interface and measured ct with cirrus linear measurement tool . although we used scans with signal strength 6 for analysis and excluded poor images , the effect of signal strength index on measurements was not investigated .\nfurthermore , we used postoperative topical steroids after cataract surgery ; thus , the true effect of phacoemulsification on oct parameters could not be evaluated and we could not determine whether and when the increased ct can return to baseline measurements .\nphacoemulsification surgery increased ct and it should be kept in mind that the small changes in ct may affect the onset of amd , which is a serious disease that results in central visual impairment .\nalthough the mechanism is unclear , it has been postulated that ct changes may also play a role in glaucoma .\nwe suggest establishment of new baseline measurements after cataract surgery for monitoring patients with glaucoma and neurodegenerative diseases .\nfurther studies with a greater number of patients and longer duration of follow - up and conducted using new computerized oct algorithms are needed .", "target": " purposewe aimed to evaluate the effect of cataract surgery on subfoveal choroidal thickness ( ct ) and ganglion cell complex ( gcc ) thickness , as measured by enhanced depth imaging - optical coherence tomography ( oct).methodsthis prospective study included 30 eyes of 30 patients who had undergone uneventful phacoemulsification surgery for senile cataract but had no previous ocular surgery or other ocular abnormality . \n best - corrected visual acuity , slit - lamp biomicroscopy , intraocular pressure , axial length , and central corneal thickness were measured preoperatively . \n the operative times ( ots ) and effective phaco times were also recorded in each case . \n oct measurements were performed at the preoperative visit and 1 month after cataract surgery . \n study of ct and gcc thickness changes was the primary objective , but central macular thickness ( cmt ) and peripapillary retinal nerve fiber layer ( rnfl ) thicknesses were also obtained by oct.resultsthe mean subfoveal ct was 294.439.2 m preoperatively and 301.439.9 m postoperatively ( p<0.001 ) . \n the mean gcc thickness was 85.04.4 m preoperatively and 89.25.3 m postoperatively ( p<0.001 ) . \n the mean cmt was 247.917.6 m preoperatively and 249.017.8 m postoperatively ( p=0.029 ) . \n the mean rnfl thickness was 97.45.4 m preoperatively and 101.75.6 m postoperatively ( p<0.001 ) . \n regression analysis showed that age , sex , axial length , central corneal thickness , operative time , and effective phaco time were not associated with ct changes ( p=0.834 , p=0.129 , p=0.203 , p=0.343 , p=0.547 , and p=0.147 , respectively ) and gcc thickness changes ( p=0.645 , p=0.542 , p=0.152 , p=0.664 , p=0.448 , and p=0.268 , respectively ) after cataract surgery.conclusionour results indicate that all subfoveal ct , cmt , as well as rnfl and gcc thicknesses are slightly affected after uneventful phacoemulsification surgery . \n after cataract surgery , the examiners should consider obtaining new baseline measurements . ", "evaluation_predictions": [2, 145, 10920, 109, 1298, 113, 61840, 24074, 29475, 326, 23005, 116, 10402, 2446, 124, 2672, 15177, 261, 1114, 110, 38954, 71508, 8617, 143, 110, 8932, 110, 158, 111, 44989, 93792, 2201, 1482, 143, 3957, 8246, 110, 158, 8617, 5844, 141, 8091, 43308, 48440, 143, 69096, 107, 3602, 110, 158, 110, 107, 106, 136, 692, 953, 7075, 1044, 170, 196, 17423, 61840, 24074, 29475, 326, 23005, 116, 10402, 2446, 118, 39298, 8647, 34468, 134, 110, 116, 63921, 4518, 2631, 941, 798, 111, 473, 2241, 317, 67886, 2191, 111, 61118, 1680, 110, 107, 106, 9252, 1382, 140, 2303, 303, 13790, 116, 116, 4412, 118, 2008, 110, 108, 824, 280, 19626, 143, 110, 11580, 208, 7897, 2651, 110, 108, 3714, 661, 1052, 110, 108, 26043, 110, 108, 20399, 110, 158, 110, 107, 106, 145, 374, 120, 302, 2672, 15177, 261, 1114, 110, 8932, 111, 3957, 8246, 8617, 1562, 2237, 244, 24074, 29475, 326, 23005, 116, 10402, 2446, 110, 107, 106, 150, 602, 4298, 120, 4761, 144, 110, 108, 2672, 15177, 261, 1114, 110, 8932, 110, 108, 110, 12360, 20603, 111, 3957, 8246, 47322, 127, 2237, 2790, 244, 24074, 29475, 326, 23005, 116, 10402, 2446, 110, 107, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]}
|
{"text": "only 2030% of patients with group a beta hemolytic streptococcus ( gabhs ) pharyngitis presents with classical symptoms of the disease .\nreliance on clinical judgment alone has a poor predictive value and results in 80% to 95% overestimation of disease [ 2 , 3 ] .\ndiagnostic strategies for acute gabhs pharyngitis are thus based on epidemiological factors , signs , and symptoms , as well as the result of throat cultures ( tcs ) .\nseveral studies have shown that the use of throat culture leads to more judicious use of antibiotics [ 57 ] .\nphysicians prescribe antibiotics for acute pharyngitis as they are concerned that patients with this complaint may be suffering from gabhs infection that if left untreated might develop suppurative complications , such as , tonsillar abscess or nonsuppurative complications , such as , rheumatic fever [ 6 , 8 ] . antibiotics , however ; confer only minor symptomatic benefits for gabhs sore throat .\nthey shorten the duration of symptoms by merely half a day on average [ 8 , 9 ] . \nmore recent studies have shown that antibiotic use only reduced the incidence of rheumatic fever by a mere 0.5 cases per 100,000 .\nthe importance of preventing rheumatic fever has lessened as the incidence of rheumatic fever and rheumatic heart disease has declined significantly in the last 20 years , from a mean annual incidence of 13.4 per 100,000 to 5 per 100,000 .\nprevalence has decreased as well from 5.7 per 1,000 in the eighties to 0.5 per 1,000 in 2000 [ 8 , 10 , 11 ] . \nthis failure probably stems from the fact that about 20% of children with gabhs is infected with bacteria which contain m protein , a virulence factor located on the surface of the bacterial wall that confers resistance to commonly used antibiotics .\nnewer beta - lactamase - resistant antibiotics did not prevent this treatment failure [ 13 , 14 ] . \nreview of the literature from 1945 to 1999 , which includes 10,484 cases of gabhs sore throat , found that antibiotic treatment reduced the occurrence of acute otitis media , a common complication of this disease , by a mere 25% , compared to the placebo group and sinusitis by only 50% .\nrheumatic fever , a nonsuppurative complication , was reduced by less than 33% , compared to placebo [ 8 , 10 , 11 , 15 ] . \nin addition to the uncertainly in the scientific literature , parents seem to be uncertain regarding the benefits of antibiotic treatment for acute gabhs pharyngitis and tend to stop treatment earlier than prescribed . in a pilot study\n, we randomly followed 75 children with gabhs pharyngitis for 6 months and have found that more than 75% of them did not complete ten days of antibiotics .\nthis finding led us to conduct a multisite , prospective cohort observational study , the results of which are reported here .\nthe goal of this study was to determine whether noncompliance with antibiotic treatment affects short - term or long - term complications .\ntwo central , primarily rural , and agricultural regions of the largest health maintenance organization ( hmo ) in israel , comprising approximately one million patients . using a standard protocol\n, we located from our computerized data base 107,840 patients , aged 6 months to 18 years , who were examined by their primary care physician for upper respiratory tract infection , tonsillitis , pharyngitis , sore throat , tonsillopharyngitis , neck pain , cervical lymphadenopathy , pta , rpa , from january 1 , 1999 until december 31 , 2000 .\nwe then accessed the charts of 78,473 of these children who were diagnosed with infected throat or one of the differential variants , excluding all children diagnosed as having viral upper respiratory infections .\n47,000 of these patients were formally diagnosed with acute pharyngitis or acute tonsillitis and received a prescription for antibiotics , indicating that their physician suspected bacterial disease . in the index visit , 35,000 of these children had at least four out of five symptoms in the modified centor criteria used for this study and nadir modified breese epidemiological and clinical score card ( ecsc ) that has 91% sensitivity and 98% specificity when the score was above 15 ( score between 4 and 36 ) for the diagnosis of gabhs [ 1719 ] .\ncolonies yielding beta - hemolysis were grouped for surface carbohydrate assessment by using a latex bead agglutination test ( figure 1 ) . of the 6336 children ( with positive cultures with 4 or more centor criteria and 15 or higher ecsc ) , 4,775 parents consented to enroll their children to the study ( figure 1 ) . excluded from the study were children who were diagnosed as gabhs chronic carriers or who had suffered from post - gabhs complications ; had any chronic illness , such as , renal or hepatic impairment ; had bleeding disorder ; had congenital or acquired immunodeficiency or suffered from malignancy . \ninitial patient / parent contact was made by one of the authors ( m. sarrell ) within 3 to 5 days of the initial positive throat culture . at that time , initial information regarding the illness and whether a prescription for antibiotics was given by the primary care physician . \nthe attending physicians of the two thousand study patients were contacted by email within 48 hours of the enrollment by one author ( m. sarrell ) .\nthe physicians were requested to inform the authors of any additional cultures taken during therapy , and to request that they obtain two additional throat cultures and engage in improve adherence strategies by providing information , counseling , reminders , reinforcement , and if needed personal attention or supervision .\nwhile repeated cultures are not routinely recommended for asymptomatic patients who have completed a course of antimicrobial therapy , in light of the poor compliance with treatment in the pilot study , performance of such follow - up cultures was considered important for the purposes of the study .\nthe first follow - up culture was performed within 10 to 14 days of the initial positive culture regardless of treatment status .\nthe purpose of this culture was verification of antibiotics treatment failure or persistence of gabhs in the oropharynx of the untreated patients .\nthe second additional throat culture was taken between days 21 and 30 after the initial positive culture , regardless of treatment status , to ascertain the presence of residual gabhs or recurrences . treating physicians\nwere also requested to obtain blood for liver enzymes , renal function tests , and urine analysis from all the participants and to perform annual follow - up evaluation thereafter . \na second patient / parent contact was made by our study coordinator within 10 to 14 days of initiation of antibiotic treatment .\nshe collected information about demographic characteristics , past medical history , febrile status , need for repeat throat culture during the treatment period ( that was not part of the study protocol ) , and type of medication prescribed . during this contact she obtained information about the number of days of actual treatment , omission compliance and complications , the patients / parents perceived as deriving from the treatment ( or lack thereof ) .\nthe computerized charts of the participants were searched within 2 to 4 weeks of the second patient / parent contact for additional information , including demographic characteristics , medical and environmental history , initial clinical data , such as , in - office fever evaluation , results of the physical examination , additional culture taken , type of antibiotics used , and disposition of prescription received .\na second search of the computerized medical charts was performed by our research assistant between 30 and 90 days of initiation of medical treatment , to ascertain that the 2 requested throat cultures were obtained . relapse or recurrence of clinical or bacterial pharyngitis ,\nsuppurative or nonsuppurative complication , or even whether the participants complained of any sore throat within 30 days of completion of treatment were also evaluated . in order to assure that all possible short - term complications that occurred within 90 days of the index case were obtained ,\nan additional comprehensive search of the hmo database was done within 120 days of the second computer search .\nwe ascertained that findings that were either not available on the original computerized chart or were seen by other than their primary care physician , ( e.g. , emergency departments , patients that relocated ) , were not overlooked .\nthe charts of the participants were then reviewed by one of the authors on a yearly basis , from january 2000 to january 2010 , noting possible late nonsuppurative complications of gabhs infection .\nno patients were lost to followup , even if they had changed physicians , due to our ability to track them through the centralized database to their new physician or another hmo .\nthe children that were enlisted to the army ( and thus not members of any hmo during their military service ) were contacted either through their former attending physician or the military physician . \nminor treatment failure was defined as any clinical or bacterial recurrence of pharyngitis during the short - term follow - up period and its correlation to compliance with treatment . \nmajor treatment failure was defined as retropharyngeal or peritonsillar abscess or long - term complications , such as rheumatic fever . \nsuppurative complications were chosen as a model , because the nonsuppurative complications ( rheumatic heart disease , arthritis , carditis ) have been practically eradicated in our region .\nthis cohort study was designed to analyze rare events ( according to the cioms classification 110 events per 10,000 children years ) .\nthe annual incidence of peritonsillar abscess ( pta ) in our region is 24 cases per 100,000 and the incidence of retropharyngeal abscess ( rpa ) is 57 cases per 100,000 . \npower calculations suggested 6,500 to 7,000 person - years of intervention would be needed to detect a 22% difference in pta and rpa between the fully treated ( ft ) and partially treated ( pt ) arms of the study population .\nfurthermore , one - sided alpha of 0.025 , a statistical power of 95% , and the pta / rpa incidence given above showed that approximately 19,000 children - years would be needed to show the noninferiority of ft versus pt . since the primary outcome of interest is the pta / rpa hazard ratio between ft and pt .\nthe null hypothesis to be tested is hr pta / rpa > 2 ( i.e. , the pta / rpa hazard ratio for ft versus pt is higher or equal to 2 ) .\nthe pta / rpa hazard ratio was calculated for ft versus pt . for purposes of analysis ,\nparticipants were divided into four subgroups based on length of treatment : 1st subgroup ( untreated ) , those who did not receive any treatment , 2nd subgroup ( partially treated ) , children that received antibiotics for 1 to 3 days , 3rd subgroup ( mostly - treated ) , children treated for 4 to 6 days , and 4th subgroup ( fully - treated ) children treated between 7 to 10 days .\ndata are presented as proportions ( with 99% confidence intervals [ cis ] ) , means ( with sds ) , or medians ( with interquartile ranges ) , using pearson tests , student 's tests , or fisher exact test .\ncomparisons of length of treatment according to time and treatment were assessed using the repeated measures and analysis of variance and the paired t test .\na 2-tailed p value of.05 was used to determine the statistical significance of differences observed between groups and to calculate confidence intervals around differences in sample means and odds ratios .\nwe used the mcnamara test to measure the changes between the groups and their subgroups regard to the length of antibiotic treatment .\nover half of their children ( 1023 , 51% ) were between the ages of 6 months and 6.9 years , and over half 1,039 ( 52% ) were female .\nthe majority of children ( 1,821 , 91% ) were prescribed penicillin or amoxicillin , allergic or intolerant to penicillin were treated with cephalosporin 25 ( 1.5% ) , erythromycin 109 ( 5.5% ) , and azithromycin 45 ( 2.5% ) , all medication were prescribed twice daily for 10 days , except azithromycin once daily for 5 days .\nno statistical correlation was found between the type of antibiotics , the children received , or the demographic characteristics and the complications found in the later medical examinations .\nonly 196 children ( 9.8% ) actually completed 10 days of antibiotic treatment . despite having received a prescription from their physician , two hundred and thirteen participants ( 11% )\ndid not start taking any treatment whatsoever , including those who did not even purchase antibiotics .\nas shown in table 1 a no statistical correlation was found concerning length frequency and duration , palatability , number of daily dose of treatment , but a statistically significant difference was found between all the subgroups concerning the length of antibiotics treatment ( p <\nthe majority of children ( 1192 , 59.6% ) had 3 days or less of fever , defined as any rectal temperature less than 38.5c or oral temperature less than 37.8c .\nthe majority of children ( 1591 , 80% ) received medication for four to six days at the most ( partially treated subgroup ) .\nas illustrated in table 1 , the association between the duration of fever and the number of days of treatment was statistically significant ( p < .0001 ) . \nof the 306 ( 15.3% ) children with clinically diagnosed recurrent tonsillopharyngitis , only 236 ( 12.3% ) had positive gabhs findings on the throat culture taken within 10 to 14 days after conclusion of the primary infection .\nan additional thirty - four ( 1.7% ) had a positive second study culture ( taken 2130 days after the index positive gabhs culture ) .\nof note is the fact that the majority ( 156 , 66% ) of the positive study culture at 1014 days were found among the subgroup treated for 7 to 10 days .\nno such positive results were found in the subgroup treated for 1 up to 3 days .\nfurthermore , no positive gabhs throat cultures were found on the second study culture in the untreated group .\nthe majority ( 26 , 76% ) of positive gabhs cultures were in the mostly treated subgroups .\nas illustrated in table 2 , these findings were both statistically significant ( p < .0001 ) ( table 2 ) . \ncervical lymphadenitis , acute otitis media , and impetigo were the only suppurative complications noted .\n110 ( 5.5% ) children developed cervical lymphadenitis , most ( 52 , 47% ) among the 6 to 7 days treatment subgroup and 33 ( 33% ) among the 4 to 5 days treatment subgroup , a significant difference among the treatment subgroups ( p < .0001 ) .\nadditionally , no children developed nonsuppurative complications during 10 years of followup nor did any of the children develop iga nephropathy during the follow - up period .\nfurthermore , they were no association between the five modified centor criteria and development of complication , even when stratified by type of antibiotics or the season of the year . altogether , 304 ( 15% )\nnew onset cases of acute otitis media ( aom ) were diagnosed within 30 days of the initial diagnosis .\nhowever , only 31 ( 10% ) of those were in the untreated subgroup , as compared to 141 ( 46% ) in the 7 to 10 days treatment subgroup , 98 ( 38% ) in the 4 to 6 days treatment subgroup and 98 ( 33% ) in the 1 to 3 days subgroup , a statistically significant difference among the all treatment subgroups ( p < .0001 ) . attempting to elucidate the possible causes for the differences between the recurrence of gabhs and the length of antibiotic treatment or clinical score on enrolment or illness severity , a multivariate stepwise logistic analysis was performed .\nthe duration of fever was the most significant predictor for such recurrence , age under 6 years being less significant , while treatment for 7 to 10 days had no significant influence on the recurrence of gabhs . \nof note is that the contribution of the duration of fever was apparent even after controlling for the concomitant influence of age , gender , medical history , single- or two - parent home , type of antibiotics or the season of the year , and concomitant illnesses , such as , conjunctivitis , otitis media , upper respiratory infection , gastroenteritis , or lymphadenitis , which may have otherwise explained the influence of the length of treatment in relation to those illnesses ( table 3 ) .\nthis study found a very poor parent / child compliance to antibiotic treatment prescribed for symptomatic , culture - positive gabhs tonsillopharyngitis .\n11% of children did not start taking any treatment at all , and only 10% completed a full course of treatment .\nthe reason for this low rate of compliance is unclear , but it coincides with other reported studies [ 14 , 16 ] . we speculate that a large proportion of lack of compliance is the parent 's sensation that antibiotics are potentially dangerous and overprescribed [ 18 , 19 ] . despite this poor compliance , in our study as in others , there was a very low rate of suppurative complications .\nfurthermore , despite the poor compliance , we found no increase in the incidence of acute rheumatic fever , the most dreaded complication of gabhs , in our patients .\nin fact , since the year 2000 , the incidence of rf in our region has declined from 2.2 per 100,000 to 0.2 per 100,000 in 2008 , according to the epidemiological department of the israeli ministry of health .\nthis is in concordance with other developed countries , including , the united states , where the original recommendation for 10 days of antibiotic treatment of gabhs originated . in that country ,\ncurrently there are only 10 cases of rf per 100,000 patients with gabhs pharyngitis , and only 1 case per 10,000 patients with acute rheumatic fever develop rheumatic heart disease [ 2022 ] .\nin fact , concomitant with the increased use of antibiotics , recurrence of gabhs in the usa rose from 9% and 10.7% in the years 1975 to 1979 , respectively , to 25.9% and 37.5% in the years 1995 to 1996 , despite the decline in acute rheumatic fever .\n14% of patients in our study had a recurrent infection , proven by a gabhs - positive throat cultures .\nthis percentage is similar to other studies which found that penicillin failed to eradicate gabhs from the throat in approximately 13% to 26% of the patients evaluated [ 23 , 24 ] .\nthe majority of recurrences in our study were in the younger group ( mean age of 10.2 years , and 60% of them younger than 9.9 years ) .\nthis is consistent with other published studies where such recurrences were more frequent among children aged 1 to 8 years than among children aged between 13 and 19 years [ 24 , 25 ] . historically ,\nprescribing 10 days of oral penicillin began in the 1950s , substituting the intramuscular injections of long - acting parenteral penicillin , based on surrogate markers of eradication of gabhs from the tonsillopharynx . however , no study has conclusively proven that this practice unequivocally prevents acute rheumatic fever [ 26 , 27 ] . even though orally prescribed penicillin appeared to be equally effective for clinical and laboratory resolution of signs and symptoms , it is difficult to administer and expensive , considering the staggering financial burden of approximately 140 office visits per annum per 1,000 children younger than 15 years [ 28 , 29 ] . substituting azithromycin or cephalosporins for penicillin was found to produce better bacteriological and clinical results and also required a shorter course of treatment [ 30 , 31 ] . \nour results may not apply to adults , sick people , or chronic gabhs carriers .\nit does not address the optimal length of treatment required to achieve appropriate eradication of the microbe or whether complete eradication is required at all .\nthe method of pill / doses counts is not a good measure of adherence , but due to it simplicity and empiric nature it was found adequate for this study .\nwe were unable to assess the true variation of the incidence of acute rheumatic fever , due to the fact that this disease has been practically eradicated from our population .\nour data suggest that the large majority of parents / patients stop administering antibiotics to their children who suffer from gabhs prior to the completion of the recommended course .\na more judicious use of antibiotics would promote and improve compliance , cut costs , and prove more convenient to parents and children alike .", "target": " \n background . \n uncertainty exists concerning the necessity of 10-day antibiotic treatment of group a beta hemolytic streptococcus ( gabhs ) pharyngitis . objective . to assess the incidence of gabhs recurrence and suppurative and nonsuppurative complications in relation to compliance \n . methods . \n ( design ) . prospective cohort observational study . \n ( subjects ) . \n 2,000 children aged 6 months to 18 years with sore throat and positive gabhs culture . \n ( main outcome measures ) . \n recurrence of symptomatic culture positive gabhs pharyngitis , incidence of suppurative , and long - term , regional , nonsuppurative complications of gabhs pharyngitis , over a ten year period . results . \n 213 ( 11% ) of the children received no treatment . \n most children received antibiotics for only 46 days ( in correlation with the duration of fever , which in most cases lasted up to 3 days ) . \n three hundred and six ( 15.3% ) children had clinically diagnosed recurrent tonsillopharyngitis ; 236 ( 12.3% ) had positive gabhs findings within 10 to 14 days and thirty - four ( 1.7% ) within 2130 days after the index positive gabhs culture . \n the remaining 1.3% had no positive culture despite the clinical findings . \n almost all recurrences [ 236 ( 11.6% ) ] occurred within 14 days and 156 ( 7.6% ) in the fully treated group . \n the presence of fever during the first 3 days of the disease was the most significant predictor for recurrence . \n other predictors were the age younger than 6 years and the presence of cervical lymphadenitis . \n no increase in the incidence of nonsuppurative or suppurative complications was noted during the 10-year follow - up period , compared to the past incidence of those complications in israel . \n conclusions . \n our data suggests that the majority of children discontinue antibiotics for gabhs tonsillopharyngitis a day or two after the fever subsides . \n the incidence of complications in our study was not affected by this poor compliance . ", "evaluation_predictions": [2, 109, 1521, 113, 19054, 791, 118, 9000, 110, 72296, 31540, 110, 60165, 10707, 127, 10920, 115, 114, 6667, 37687, 692, 110, 107, 106, 2216, 156, 604, 404, 115, 228, 4000, 113, 110, 83852, 195, 8905, 118, 136, 1568, 204, 114, 908, 113, 530, 231, 110, 107, 106, 13448, 195, 8752, 118, 9000, 110, 72296, 31540, 110, 60165, 10707, 115, 228, 771, 110, 151, 305, 110, 158, 118, 305, 112, 296, 390, 209, 110, 108, 111, 280, 110, 158, 118, 384, 112, 530, 390, 209, 110, 107, 106, 109, 2072, 113, 791, 140, 5844, 303, 109, 446, 38511, 17969, 9158, 23746, 110, 108, 3365, 130, 189, 17838, 9550, 1972, 478, 197, 132, 3294, 112, 296, 25413, 1152, 111, 4868, 1972, 478, 197, 132, 3294, 112, 296, 35292, 1152, 110, 107, 106, 126, 140, 374, 120, 186, 140, 114, 221, 580, 872, 113, 47032, 4205, 8757, 7923, 110, 108, 253, 130, 110, 108, 22085, 21997, 42088, 10707, 110, 108, 9000, 30807, 10707, 636, 110, 108, 111, 609, 116, 768, 8753, 8757, 7923, 110, 108, 115, 150, 692, 110, 107, 106, 21905, 110, 108, 114, 24434, 1225, 1347, 140, 374, 317, 109, 2072, 113, 13448, 791, 143, 891, 110, 105, 110, 107, 41711, 110, 158, 111, 109, 2072, 113, 791, 143, 891, 110, 105, 110, 107, 106, 110, 41711, 110, 158, 110, 108, 114, 1225, 1347, 790, 109, 149, 791, 64307, 143, 891, 110, 105, 110, 107, 41711, 110, 158, 110, 107, 106, 109, 205, 1225, 44777, 118, 253, 30322, 140, 109, 5400, 113, 9817, 110, 108, 779]}
|
{"text": "neurofibromatosis affects 1:3,000 individuals , and characterized by largely benign but often debilitating tumors that grow in the nervous system .\nits course is unpredictable : it can cause a variety of benign nerve tumors including plexiform , dermal , and optic glioma tumors ; in some cases malignant peripheral nerve sheath tumors can develop in the plexiform tumours .\ndown 's syndrome is one of the most common and easily recognized genetic conditions in humans .\nthe estimated prevalence in the united states is approximately 15 per 10,000 live births ( ie , 1 out of every 700 )\nmost often , it is the result of nondisjunction on chromosome 21 during maternal meiotic division .\nwe herein present the case of a 17-year - old boy with complaints of skin lesions over the back associated with mild itching since 3 months .\nhe was a known case of down 's syndrome with a history of seizures in childhood [ figure 1 ] .\nthe lesions gradually increased in size and number , and similar lesions started developing over his forehead since 23 weeks . on examination , multiple skin colored papules of varying size were present over the entire back and the forehead .\nvelvety thickening of the skin and hyperpigmentation of the axillae suggestive of acanthosis nigricans was present .\nthe characteristic features of down 's syndrome , including simian crease , mongoloid facies , and mental retardation were present .\ncanities and a solitary keloid over the chest were also seen apart from the clinical features of down 's syndrome . on oral examination , scrotal tongue , abnormal dentition , and\nother investigations such as ct scan brain , 2d echo , and ecg were normal .\nhistopathology of the nodule from the back revealed focally thinned out epidermis with intact basal layer ; the papillary dermis showed a mild perivascular infiltrate .\ndeeper dermis showed a benign spindle cell proliferation suggestive of neurofibromatosis [ figure 3 ] .\nphysical appearance of down 's syndrome ( a ) neurofibromas ( b ) sebaceous cyst ( c ) acanthosis nigricans , and axillary freckling ( d ) scrotal tongue focally thinned out epidermis with intact basal layer with the papillary dermis showing a mild perivascular infiltrate .\nthe presentation of a patient with two unrelated genetic disorders is uncommon , although not statistically impossible .\nhowever , in two of these reports , a third medical condition was also present . in one report , breast cancer was reported . in the other ,\nour patient had down 's syndrome , neurofibromatosis , dental anomalies , and ocular defects and keloids . in the large majority of cases , trisomy 21\nthere is no current evidence to support the idea that this is anything other than a chance occurrence .\nthe two conditions are not related , and the likelihood of a person being born with these two conditions is approximately 1 in 2,700,000 births .\nthey however overlap in their manifestations . both are associated with intellectual impairment to differing degrees .\nmacroglossia occurs in both conditions , as may facial , dental , and occlusal abnormalities .\nhearing and speech are affected in both conditions , as may the ability to maintain an acceptable level of oral hygiene .\nmutations in the gene results in abnormal control of cell growth , differentiation , and aberrant myelination . our patient with of neurofibrmatosis type 1 with down 's syndrome is the first such to have a keloid and sebaceous cyst apart from myopia and dental anomalies . the unpredictable nature and course of the two genetic disorders along with multiple acquired conditions in this patient make it difficult for patients , teachers , care givers , and medical / dental providers to create and maintain long - term care plans . the authors certify that they have obtained all appropriate patient consent forms . in the form the patient(s )\nhas / have given his / her / their consent for his / her / their images and other clinical information to be reported in the journal .\nthe patients understand that their names and initials will not be published and due efforts will be made to conceal their identity , but anonymity can not be guaranteed .\nthe authors certify that they have obtained all appropriate patient consent forms . in the form the patient(s )\nhas / have given his / her / their consent for his / her / their images and other clinical information to be reported in the journal .\nthe patients understand that their names and initials will not be published and due efforts will be made to conceal their identity , but anonymity can not be guaranteed .", "target": " we report a patient with down 's syndrome and neurofibromatosis who presented with a keloid , sebaceous cyst and acanthosis nigricans , along with dental and ophthalmological defects . \n the coexistence of neurofibromatosis type 1 and down 's syndrome which are two unrelated genetic conditions is itself a rarity . ", "evaluation_predictions": [2, 308, 1034, 116, 8364, 117, 156, 113, 109, 205, 830, 111, 831, 2982, 6761, 1047, 115, 4095, 110, 107, 106, 308, 1034, 116, 8364, 117, 156, 113, 109, 205, 830, 111, 831, 2982, 6761, 1047, 115, 4095, 110, 107, 106, 109, 2583, 113, 114, 1532, 122, 228, 18877, 6761, 5962, 117, 11467, 110, 108, 1670, 146, 24434, 3394, 110, 107, 106, 145, 15600, 799, 109, 437, 113, 114, 18429, 1019, 233, 459, 2955, 122, 6337, 113, 769, 23790, 204, 109, 247, 1589, 122, 6140, 39776, 381, 296, 590, 110, 107, 124, 4712, 110, 108, 1079, 769, 6074, 47574, 33595, 7775, 115, 628, 111, 344, 106, 195, 799, 204, 109, 954, 247, 111, 18761, 110, 107, 124, 4712, 110, 108, 9506, 556, 113, 308, 1034, 116, 8364, 110, 108, 330, 16655, 3262, 28105, 110, 108, 87774, 47945, 72736, 116, 110, 108, 111, 2287, 81945, 195, 799, 110, 107, 106, 137, 7398, 111, 114, 20318, 13793, 47945, 204, 109, 5319, 195, 163, 684, 2971, 135, 109, 2827, 556, 113, 308, 1034, 116, 8364, 110, 107, 106, 124, 4868, 4712, 110, 108, 75026, 9550, 7838, 110, 108, 16527, 23148, 24693, 110, 108, 111, 110, 8932, 5499, 2037, 110, 108, 280, 252, 16669, 110, 108, 111, 176, 9051, 253, 130, 110, 8932, 5499, 2037, 110, 108, 280, 252, 16669, 110, 108, 111, 860, 49225, 195, 1644, 110, 107, 124, 4868, 4712, 110, 108, 106, 75026, 9550, 7838, 110, 108, 16527, 23148, 24693, 110, 108, 111, 176, 9051, 253, 130, 110, 8932, 5499, 2037, 110, 108, 280, 252, 16669, 110]}
|
{"text": "Poolside convo about your summer last night, ooh yeah\nAbout your summer last night\nAint give you no play, mmm\nCould I make you shive last night?\nCould I make you shy on the last night, last night?\nCould we make it in? Do we have time?\nIll be the boyfriend in your wet dreams tonight\nNoses on a rail, little virgin wears the white\nYou cut your hair, but you used to live a blonded life\nWish I was there, wish wed grown up on the same advice\nAnd our time was right\nKeep a place for me, for me\nIll sleep between yall, its nothing\nIts nothing, its nothing\nKeep a place for me, for me\nNow and then, you miss it, sounds make you cry\nSome nights, you dance with tears in your eyes\nI came to visit, cause you see me like a UFO\nThats like never, cause I made you use your self-control\nAnd you made me lose my self-control, my self-control\nKeep a place for me, for me\nIll sleep between yall, its nothing\nKeep a place for me\nIts nothing, its nothing\nIts nothing, its nothing\nSometimes youll miss it\nAnd the sound will make you cry\nAnd some nights, youre dancing\nWith tears in your eyes\nI, I, I know you gotta leave, leave, leave\nTake down some summertime\nGive up, just tonight, night, night\nI, I, I know you got someone comin\nYoure spittin game, know you got it\nI, I, I know you gotta leave, leave, leave\nTake down some summertime\nGive up, just tonight, night, night\nI, I, I know you got someone comin\nYoure spittin game, know you got it \nI, I, I know you gotta leave, leave, leave\nTake down some summertime\nGive up, just tonight, night, night\nI, I, I know you got someone comin\nYoure spittin game, know you got it"}
|
{"text": "I will always love you\nHow I do\nLet go of a prayer for you\nJust a sweet word\nThe table is prepared for you\nWishing you godspeed, glory\nThere will be mountains you wont move\nStill, Ill always be there for you\nHow I do\nI let go of my claim on you\nIts a free world\nYoull look down on where you came from sometimes\nBut youll have this place to call home always\nThis love will keep us through blinding of the eyes\nSilence in the ears, darkness of the mind \nThis love will keep through blinding of the eyes \nSilence in the ears, darkness of the mind \nThis love will keep us through blinding of the eyes \nSilence in the ears, darkness of the mind\nOh, oh\nIll always love you\nUntil the time we die\nOh, oh"}
|
{"text": "2003\nArizona Iced Out Boys\nYung Leandoer, shawty\nEmotional boys, 2001\nEmotional shawties in this bitch\nMakaveli\nBitches come and go, brah\nBut you know I stay\nBitches come and go, brah\nBut you know I stay\nGot my balls licked\nBy a Zooey Deschanel look-alike cocaine addict\nRazor blade to your head\nConflict, Im a contradicted shit\nPeeing on old peoples houses is an inflict\n2003 shit\nThis aint no splitting bills shit\nIma peel banana skids\nWhile listenin to R. Kellys greatest hits\nYung Lean in the club\nFor some morphine \nYung Lean up in the club\nFor some morphine \nPoppin pills like zits\nWhile someone vomits on your mosquito tits\nSlitting wrists while dark evil spirits like Slytherin\nSlither in with tricks, Im sick\nAcid trip makes my spitting sick\nAnd makes me start hitting chicks\nKnitting thick, shitting quick, fitting dick\nLike transmitting shit with an AIDS stick\nThink youre gay as fuck like a fish stick\nTequila shots and salt licks\nGetting balls in your face like a free kick\nYung Lean stays motherfuckin freaky \nYung Lean in the club\nFor some morphine \nYung Lean up in the club\nFor some morphine \nRotten teeth like Gargamel\nCast a spell, you keep on tryin to yell\nBet your dead body stinks worse than my Swell\nWell, Lean expels\nDiagrams as if they were made in Excel\nFuck fat hoes like Adele\nGet my dick stuck inside a lamp shell\nGet it out with sperm cells and hair gel\nSwim in Mexico, mademoiselle\nPoint and laugh while he fell\nWhos laughing now, now that Im explosive like Alfred Nobel\nYung Lean only attracts an older clientele\nVery well"}
|
{"text": "I could jump off a bridge and let you walk over me\nI tend to stay inside myself, I dont want you to take over me\nIve been jet skiin, jet skiin in Dubai\nIve been jet skiin, jet skiin in Dubai\nDubai shit, Dubai whips\nDifferent place, different chips \nATL, this shit ludicrous \nOh well, they like who that is \nYeah, Dubai shit, Dubai whips \nDifferent place, different chips \nATL, this shit ludicrous \nKnow me well, know who that is \nI dont know, where to go \nLife round here is just hysterical \nJ. Will here, know he sneakin Os \nGive those here, you cant handle those \nEnemies, M.I.A. \nAt Ace of Diamonds with Ace of Spades \nWe at Club White, aint no Mandalay \nYou cant get in, nah \nDubai shit, Dubai whips\nDifferent place , different chips \nA-T-L, this shit ludicrous , yeah \nKnow me well, they know who that is \nTrampoline , Michael Jordan dreams \nHalf a bale in that vacuum clean \nAbu Dhabi on them jet skis \nWant straight cash, no checks please \nShoot out that coupe , what you gon do? \nIm handin out allowances to all my goons \nIn Dubai, Im smokin cookie in the hotel rooms \nGot me paranoid, think its an Esco move \nDubai shit, Dubai whips\nDifferent place, different chips \nATL, this shit ludicrous \nOh well, like like who that is \nOh, yeah, birds fly high out in Dubai\nRidin all these jet skis in Dubai \nSo much money, my jet ski gold \nFish bowl , Super Bowl \nI played with Montana and Rice before \nHuncho not tellin no lie, oh, its so hot in Dubai\nI see your soul in your eyes , I let the opium dry \nGood drank , mixed with antidote \nI put her on Molly, Cac put her on snow \nNever was a fan of the Os , came from the land of the Nawf\nWhippin the pan on the stove , whip it til your hand grow mold \nDubai shit, Dubai whips\nDifferent place, different chips \nATL, this shit ludicrous \nOh well, like like who that is \nYeah, Dubai shit, Dubai whips \nDifferent place, different chips \nATL, this shit ludicrous \nKnow me well, know who that is \nIve been jet skiin, jet skiin in Dubai\nIve been jet skiin, jet skiin in Dubai"}
|
{"text": "Whats up, whats up\nSuicideyear, ooh\nSadboys\nShawty Ima do things that you aint never did\nFinna wake up next to you in my crib\nCause Ima make you hurt\nIma, Ima make you hurt\nIma make you hurt\nIma, Ima make you hurt\nShawty Ima do things that you aint never did\nFinna wake up next to you in my crib\nCause Ima make you hurt\nIma, Ima make you hurt\nIma make you hurt\nIma, Ima make you hurt\nSadboys, we on deck\nAm I awake? I gotta check\nWent to sleep, never came back\nIm the same guy smoking loud pack\nIced out, right back\nPCP attack, 3D pills\nHoes on my ball sack\nThey dont know how to act\nHigh tech watch, high tech locked\nBroken skies, fantastic fox\nGot keys, but Ill never find the lock\nEmotionalboys we in the UFO\nSkies pink when Im on ecstasy\nIn Tokyo, playing Mario\nSadboys blastin your stereos\nSucking on my nuts like pistachios\nMixing champagne with Carpaccio\nSlangin dough, hoe Im in that polo\nStacks of money, more for you\nMilkshakes with the crushed up oreos\nIm in Italy, Rodeo\nForgive me after my death, Caravaggio\nLouis duffle bag filled with heroin\nLouis goons who finna trip on LSD acid tabs, let em in\nLouis duffle bag filled with heroin\nLouis goons who finna trip on LSD acid tabs, let em in\nIma make you hurt\nIma, Ima make you hurt\nIma make you hurt\nIma, Ima make you hurt\nBitch I light up the sky, call me Charmeleon\nMy lifes on the line\nI aint Charmander, but Im nearly on\nClearly on drugs\nThat will make you hear, clearly wrong\nLonger than my yearly bong hit\nShawty thinks she got style\nLeandoer dresses slicker\nIm so iced out that its winter\nDestroy my stupid liver\nI be on that Bape shit, you rocking Quicksilver\nNever hesitate shit, to pull the trigger\nLuxurious steak before my dinner\nThrow bodies down the river\nYeah, you get that picture\nGold and silver round my finger\nShawty on that West Side, she a gold digger\nWake up and Im a winner\nShowering in five star\nHoe take a look in the mirror\nIm on my grind like all the time\nBitch Im Murakami\nShawty sucking on my pastrami, get that salami\nIma make you hurt\nIma make you hurt\nIma, Ima make you hurt\nIma make you hurt\nShawty Ima do things you aint never did\nFinna wake up next to you in my crib\nCause Ima make you hurt\nIma, Ima make you hurt\nIma make you hurt\nIma, Ima make you hurt\nShawty Ima do things that you aint never did\nFinna wake up next to you in my crib\nCause Ima make you hurt\nIma, Ima make you hurt\nIma make you hurt\nIma, Ima make you hurt\nLouis duffle bag filled with heroin\nLouis Louis Louis duffle bag filled with heroin\nLouis Louis Louis duffle bag filled with heroin\nIma Ima Ima make you hurt\nIma make you hurt\nSadboys"}
|
{"text": "I-I-I love how she dancing, got me fiending for you\nYou say that you love me, I dont know if its true\nWhen I go to sleep all I ever see is you\nI can be your savior, everything that weve been through\nI love how she dancing, got me fiending for you\nYou say that you love me, I dont know if its true\nWhen I go to sleep all I ever see is you\nI can be your savior, everything that weve been through\nI be, I be grinding, making money, its for me and you\nI love the way you dancing and your top is see-through\nWe can go up to the stars, see clouds and fall through\nMoney in my pocket and you know I want you\nIve been busy, got so much work, I cant always be with you\nPercocets my system, when I go to sleep I know its you\nWhen I was in the hospital, I saw you\nI know what you feel inside cause I feel you\nI gotta stay true, my money rain blue\nHennessy and Sailor Moon, I just wanna be with you\nI know what your feelings are cause I know I feel you\nMy money rain blue, Hennessy and Sailor Moon\nI-I-I love how she dancing, got me fiending for you\nYou say that you love me, I dont know if its true\nWhen I go to sleep all I ever see is you\nI can be your savior, everything that weve been through\nI love how she dancing, got me fiending for you\nYou say that you love me, I dont know if its true\nWhen I go to sleep all I ever see is you \nI can be your savior, everything that weve been through\nShe shouldnt have to ask, whatever she wants\nI stay up till dawn, barbed wire on my arm\nThey wanna see me fall, they wanna see me fall\nI dont care at all, Im a young rockstar\nLivin in the dark, livin in the dark\nLeandoer the God, weve been goin hard\nEver since she called, I dont have a heart\nI went to the stars\nWhat you want from me? I can get it for you\nGet-get-get-get-get it for you\nYou-you-you dont, you dont want me, do you? \nYou dont want me, do you? \nKnow what Ill do to you\nI-I-I love how she dancing, got me fiending for you \nYou say that you love me, I dont know if its true \nWhen I go to sleep all I ever see is you\nI can be your savior, everything that weve been through\nI love how she dancing, got me fiending for you \nYou say that you love me, I dont know if its true \nWhen I go to sleep all I ever see is you\nI can be your savior, everything that weve been through"}
|
{"text": "Le-Le-Leandoer\nS-Sad Boys\nNever\nSad Boys\nIce droppin, red bottom sky\nIntrigued by the moment, look like she know why\nIce droppin, red bottom sky\nIce on my feet, I keep slippin \nIce droppin, red bottom sky\nIntrigued by the moment, look like she know why\nIce droppin, red bottom sky\nIce on my feet, I keep slippin \nSoldiers in the night and we lurkin\nMedieval flowers in my church, we workin\nIm in the bottomless pit, Silver Surfer surfin\nI lived a thousand lives, but Im still searchin \nBroken glass in my hands, sisters twerkin\nMoney on the floor and she nervous\nPaint a picture like Van Gogh, Im cursed man\nSkrrt skrrt to the moon, bitch, Im swervin \nHit the curve and my shit broke bitch hurtin\nI was down, so deep down but times turnin \nDarkness in my mind, flip the mattress, I got dough \nHarvest on my line, I live the story I was told \nIce droppin, red bottom sky\nIntrigued by the moment, look like she know why\nIce droppin, red bottom sky\nIce on my feet, I keep slippin \nIce droppin, red bottom sky\nIntrigued by the moment, look like she know why\nIce droppin, red bottom sky\nIce on my feet, I keep slippin \nI heard shooters on the roof, yeah, they tryna shoot ya\nIm in a dark room, candles singin hallelujah\nYou think Im gone too much, well, I think I suit you\nYou say Im in my mind too much, well, I know that suits you\nI lost everything, only thing Im scared is to lose you\nI heard voices in my head, yeah, they whispered to us\nParanoid, sledgehammer, thats my Ruger\nWoke up, realized I had to move up \nWorked my soul away everyday, now my loot up\nBut the truth is, I wish I never knew us\nGod of violence, pink dreams in my two cup\nIve told you this was gonna end, but I fooled you\nIce droppin, red bottom sky\nIntrigued by the moment, look like she know why\nIce droppin, red bottom sky\nIce on my feet, I keep slippin\nIce droppin, red bottom sky\nIntrigued by the moment, look like she know why\nIce droppin, red bottom sky\nIce on my feet, I keep slippin\nFeels like Im walkin on water, not wine\nCut off my fingers to touch your smile\nFeels like Im walkin on water, not wine\nCut off my fingers to touch your smile\nIce droppin, red bottom sky\nIntrigued by the moment, look like she know why\nIce droppin, red bottom sky\nIce on my feet, I keep slippin \nIce droppin, red bottom sky\nIntrigued by the moment, look like she know why\nIce droppin, red bottom sky\nIce on my feet, I keep slippin"}
|
{"description": "Covers all areas of AI except Vision, Robotics, Machine Learning, Multiagent Systems, and Computation and Language (Natural Language Processing), which have separate subject areas. In particular, includes Expert Systems, Theorem Proving (although this may overlap with Logic in Computer Science), Knowledge Representation, Planning, and Uncertainty in AI. Roughly includes material in ACM Subject Classes I.2.0, I.2.1, I.2.3, I.2.4, I.2.8, and I.2.11.", "category_id": "cs.AI", "category_name": "(Artificial Intelligence)"}
|
{"description": "Covers systems organization and hardware architecture. Roughly includes material in ACM Subject Classes C.0, C.1, and C.5.", "category_id": "cs.AR", "category_name": "(Hardware Architecture)"}
|
{"description": "Covers models of computation, complexity classes, structural complexity, complexity tradeoffs, upper and lower bounds. Roughly includes material in ACM Subject Classes F.1 (computation by abstract devices), F.2.3 (tradeoffs among complexity measures), and F.4.3 (formal languages), although some material in formal languages may be more appropriate for Logic in Computer Science. Some material in F.2.1 and F.2.2, may also be appropriate here, but is more likely to have Data Structures and Algorithms as the primary subject area.", "category_id": "cs.CC", "category_name": "(Computational Complexity)"}
|
{"description": "Covers applications of computer science to the mathematical modeling of complex systems in the fields of science, engineering, and finance. Papers here are interdisciplinary and applications-oriented, focusing on techniques and tools that enable challenging computational simulations to be performed, for which the use of supercomputers or distributed computing platforms is often required. Includes material in ACM Subject Classes J.2, J.3, and J.4 (economics).", "category_id": "cs.CE", "category_name": "(Computational Engineering, Finance, and Science)"}
|
{"description": "Roughly includes material in ACM Subject Classes I.3.5 and F.2.2.", "category_id": "cs.CG", "category_name": "(Computational Geometry)"}
|
{"description": "Covers natural language processing. Roughly includes material in ACM Subject Class I.2.7. Note that work on artificial languages (programming languages, logics, formal systems) that does not explicitly address natural-language issues broadly construed (natural-language processing, computational linguistics, speech, text retrieval, etc.) is not appropriate for this area.", "category_id": "cs.CL", "category_name": "(Computation and Language)"}
|
{"description": "Covers all areas of cryptography and security including authentication, public key cryptosytems, proof-carrying code, etc. Roughly includes material in ACM Subject Classes D.4.6 and E.3.", "category_id": "cs.CR", "category_name": "(Cryptography and Security)"}
|
{"description": "Covers image processing, computer vision, pattern recognition, and scene understanding. Roughly includes material in ACM Subject Classes I.2.10, I.4, and I.5.", "category_id": "cs.CV", "category_name": "(Computer Vision and Pattern Recognition)"}
|
{"description": "Covers impact of computers on society, computer ethics, information technology and public policy, legal aspects of computing, computers and education. Roughly includes material in ACM Subject Classes K.0, K.2, K.3, K.4, K.5, and K.7.", "category_id": "cs.CY", "category_name": "(Computers and Society)"}
|
{"description": "Covers database management, datamining, and data processing. Roughly includes material in ACM Subject Classes E.2, E.5, H.0, H.2, and J.1.", "category_id": "cs.DB", "category_name": "(Databases)"}
|
{"input_ids": [65, 386, 1170, 7591, 3655, 609, 474, 4956, 517, 363, 16604, 2686, 1242, 386, 1170, 7591, 3127, 1276, 66, 1679, 1930, 9851, 388, 363, 10917, 9404, 633, 321, 31367, 1679, 1930, 9851, 388, 363, 10917, 9404, 16004, 385, 1159, 16509, 938, 3090, 4192, 736, 1159, 5929, 633, 1679, 1930, 2417, 1679, 1930, 9851, 388, 363, 10917, 9404, 2243, 387, 363, 10917, 9404, 2394, 11119, 387, 6062, 6780, 25119, 321, 439, 1469, 420, 15040, 938, 1069, 5929, 938, 388, 32912, 7637, 32054, 633, 31093, 13498, 5929, 938, 1679, 1930, 7560, 8355, 759, 1679, 1930, 11357, 962, 37604, 9858, 37604, 26841, 37604, 20866, 1293, 37604, 438, 5168, 37604, 1621, 45171, 391, 2867, 5427, 909, 8228, 1858, 550, 114, 9568, 823, 5379, 3318, 32043, 12723, 10216, 468, 15674, 8427, 6062, 6780, 25119, 33515, 12123, 1936, 8386, 10033, 537, 10216, 20866, 35920, 6134, 4728, 3630, 1679, 1930, 9851, 388, 363, 10917, 9404, 10917, 9404, 410, 797, 3814, 2584, 22144, 676, 4164, 16585, 4620, 44514, 6199, 10378, 15544, 1911, 453, 402, 2550, 6514, 4490, 17268, 453, 402, 428, 16216, 48085, 12686, 19756, 10375, 5367, 1911, 5515, 4549, 24677, 541, 7740, 491, 2550, 6514, 463, 459, 500, 620, 2141, 9010, 41939, 15040, 10917, 38177, 49103, 2550, 6514, 428, 7445, 21973, 2648, 1474, 4287, 5475, 392, 541, 174, 519, 7679, 5129, 17652, 18435, 15577, 24677, 5934, 23128, 10224, 17769, 8948, 6352, 3087, 676, 4694, 48812, 1980, 47948, 383, 19027, 9139, 2584, 22144, 448, 6626, 24677, 453, 402, 12794, 3666, 35941, 24677, 463, 459, 12794, 3666, 20240, 404, 33087, 614, 4473, 500, 620, 2141, 614, 4473, 428, 16216, 48085, 12686, 258, 21208, 10989, 10917, 1478, 1706, 10077, 458, 1349, 2332, 1478, 14163, 1368, 10917, 1478, 1706, 1911, 1478, 410, 7596, 898, 37865, 1478, 18519, 1538, 22242, 7790, 1478, 10224, 40669, 11118, 1911, 1478, 3087, 2675, 629, 5083, 13855, 1911, 1478, 7265, 4597, 9404, 1478, 500, 620, 2141, 572, 14720, 1478, 10917, 9404, 1478, 15544, 1911, 1478, 10375, 5367, 1911, 484, 1679, 1930, 9851, 388, 363, 10917, 9404, 474, 15742, 391, 9876, 29197, 938, 818, 6594, 391, 889, 42506, 26437, 10917, 25980, 1242, 363, 2379, 32054, 633, 14163, 865, 1215, 1212, 3135, 391, 2065, 3941, 938, 363, 572, 114, 151, 114, 1331, 4244, 4956, 984, 609, 12131, 363, 8733, 387, 1277, 938, 1872, 585, 2815, 427, 1277, 36592, 494, 508, 865, 418, 1699, 6732, 474, 363, 4242, 43774, 388, 5929, 938, 719, 363, 572, 114, 151, 114, 4956, 363, 376, 11230, 11534, 1169, 7371, 1331, 387, 4033, 10195, 12686, 258, 21208, 480, 363, 741, 387, 363, 1706, 7612, 1911, 458, 45379, 633, 47902, 1368, 865, 14582, 385, 5427, 909, 8228, 321, 439, 23267, 420, 2906, 705, 938, 35246, 938, 363, 572, 114, 151, 114, 5171, 5771, 420, 756, 6610, 363, 10917, 2523, 427, 21213, 2324, 523, 363, 572, 114, 151, 114, 2523, 662, 1112, 1396, 712, 3261, 391, 3220, 387, 572, 114, 151, 114, 23071, 2978, 388, 363, 1600, 648, 22801, 865, 2093, 4078, 8543, 410, 15041, 2009, 618, 6654, 385, 363, 1395, 633, 5929, 4966, 576, 851, 508, 1350, 707, 385, 22533, 388, 363, 5459, 938, 358, 1546, 644, 3263, 6987, 865, 41318, 1242, 363, 9404, 938, 363, 572, 114, 151, 114, 2009, 6654, 757, 5929, 865, 8692, 484, 572, 114, 151, 114, 8119, 363, 1331, 387, 20240, 12564, 27351, 461, 270, 1132, 388, 1349, 3796, 938, 835, 913, 807, 461, 270, 1132, 321, 439, 12193, 389, 107, 266, 184, 366, 3282, 784, 385, 1277, 865, 461, 270, 1132, 321, 439, 991, 3997, 387, 5929, 3282, 2070, 3135, 11214, 1123, 363, 835, 2779, 938, 2693, 1302, 461, 270, 1132, 10994, 2065, 1603, 427, 3243, 1698, 385, 31248, 865, 655, 40518, 938, 2259, 938, 461, 270, 1132, 3022, 382, 2821, 385, 358, 572, 114, 151, 114, 10200, 938, 3801, 5945, 32471, 938, 388, 644, 461, 270, 1132, 5182, 440, 662, 508, 1158, 430, 403, 113, 14401, 388, 32054, 2263, 363, 2744, 3022, 4586, 385, 1509, 8059, 387, 2886, 5972, 865, 461, 270, 1132, 17788, 2342, 938, 5067, 430, 403, 113, 14401, 938, 391, 22260, 363, 3857, 5572, 4641, 938, 6134, 415, 114, 4728, 3630, 865, 10917, 44448, 3262, 385, 363, 32054, 3096, 651, 7295, 5574, 420, 363, 572, 114, 151, 114, 1836, 387, 363, 4966, 938, 358, 4013, 4728, 3630, 3868, 865, 780, 13638, 5929, 391, 1819, 5574, 388, 3087, 11467, 938, 4037, 391, 1545, 430, 9343, 2750, 387, 363, 32054, 7125, 938, 2342, 456, 37143, 1994, 938, 391, 12354, 1205, 523, 363, 10917, 762, 865, 2500, 5325, 387, 3087, 20995, 451, 14264, 270, 851, 9110, 12354, 611, 2543, 755, 938, 3674, 388, 5929, 321, 439, 5194, 865, 484, 572, 114, 151, 114, 9759, 604, 387, 363, 34603, 3096, 1667, 2906, 819, 938, 32317, 938, 719, 2093, 4078, 8543, 410, 15041, 50267, 3487, 420, 363, 572, 114, 151, 114, 633, 5929, 4966, 865, 7660, 655, 1346, 529, 474, 382, 9673, 388, 10917, 4920, 938, 391, 385, 36884, 441, 4102, 363, 1679, 1930, 651, 15107, 461, 270, 1132, 865, 5001, 363, 1679, 1930, 3669, 385, 524, 19290, 382, 18427, 2551, 3913, 5929, 938, 388, 1210, 441, 474, 363, 4013, 430, 363, 572, 114, 151, 114, 7660, 3988, 32057, 17811, 1123, 32054, 391, 31093, 8460, 363, 20343, 938, 391, 388, 850, 2764, 363, 1378, 1205, 387, 572, 114, 151, 114, 4874, 388, 764, 6632, 430, 1277, 865, 655, 1224, 1440, 938, 363, 3763, 388, 2770, 2683, 3001, 420, 764, 750, 2561, 452, 363, 1077, 1670, 4512, 695, 441, 651, 7418, 6342, 388, 6594, 707, 865, 10249, 484, 572, 114, 151, 114, 3001, 1129, 363, 25980, 441, 4294, 2822, 719, 585, 2641, 15562, 4889, 3854, 385, 572, 114, 151, 114, 13194, 391, 1698, 5454, 865, 1750, 461, 270, 1132, 474, 4238, 385, 11032, 388, 32317, 391, 6134, 415, 114, 4728, 3630, 474, 7119, 1994, 388, 3368, 32317, 938, 363, 572, 114, 151, 114, 1994, 474, 358, 30349, 22146, 865, 484, 572, 114, 151, 114, 20757, 385, 5929, 938, 8717, 15117, 8228, 474, 7418, 22436, 385, 363, 750, 7243, 938, 576, 3053, 1726, 757, 5459, 452, 441, 865, 20757, 8228, 863, 6575, 452, 3712, 12723, 10216, 468, 15674, 8427, 385, 50252, 4728, 3630, 865, 484, 1679, 1930, 1331, 840, 8409, 14344, 49394, 1994, 5427, 909, 8228, 6621, 385, 7665, 468, 15674, 8427, 321, 439, 1331, 865, 4799, 2093, 8228, 938, 363, 1679, 1930, 651, 2009, 6654, 385, 5295, 391, 22366, 44514, 6199, 10378, 865, 2093, 8228, 321, 439, 1331, 8119, 363, 1331, 387, 10033, 537, 10216, 20866, 35920, 388, 32163, 938, 644, 3243, 5202, 523, 363, 572, 114, 151, 114, 385, 5303, 385, 20866, 35920, 321, 439, 3487, 865, 1750, 2067, 20866, 35920, 12626, 938, 6062, 6780, 25119, 7485, 363, 4966, 3341, 387, 15040, 938, 1069, 5929, 388, 32912, 938, 363, 572, 114, 151, 114, 5508, 840, 5316, 114, 1858, 550, 114, 9568, 823, 19290, 784, 388, 358, 33053, 4466, 938, 2001, 456, 363, 6062, 6780, 25119, 38177, 865, 484, 572, 114, 151, 114, 4155, 388, 363, 1489, 9533, 387, 427, 9614, 938, 644, 474, 385, 8107, 25119, 865, 20866, 35920, 4238, 363, 572, 114, 151, 114, 385, 8500, 2074, 363, 4966, 865, 418, 27932, 15365, 419, 1796, 480, 43141, 387, 363, 10917, 9404, 26815, 458, 7909, 1368, 453, 27626, 633, 1706, 14580, 391, 572, 114, 151, 114, 25583, 388, 9234, 2354, 463, 461, 24806, 13831, 2417, 463, 114, 117, 484, 572, 114, 151, 114, 391, 363, 25626, 387, 4728, 3630, 938, 34564, 633, 35246, 463, 114, 118, 572, 114, 151, 114, 391, 468, 15674, 8427, 7243, 35246, 633, 1579, 463, 114, 119, 32912, 1478, 24269, 463, 114, 120, 25960, 1478, 31093, 614, 8809, 37670, 388, 5929, 705, 572, 114, 151, 114, 2523, 39112, 743, 4192, 736, 819, 11923, 868, 31559, 908, 34680, 6218, 27626, 633, 1706, 14580, 391, 572, 114, 151, 114, 25583, 388, 9234, 2354, 458, 4471, 1368, 8875, 2809, 1159, 9234, 2354, 1478, 1679, 1930, 2417, 26934, 16352, 517, 1858, 410, 114, 2083, 26355, 40657, 21391, 363, 1679, 1930, 35213, 2067, 7998, 20949, 523, 612, 1370, 44393, 458, 4943, 17689, 26934, 1368, 572, 114, 151, 114, 3316, 2551, 3913, 9234, 2354, 474, 385, 7149, 363, 3915, 474, 363, 16659, 387, 4689, 387, 363, 572, 114, 151, 114, 938, 7418, 36978, 388, 363, 26350, 35642, 865, 655, 363, 19398, 1867, 2588, 661, 385, 363, 26350, 35642, 938, 2093, 36595, 19398, 21736, 363, 1679, 1930, 806, 927, 385, 22533, 2137, 3194, 388, 363, 3915, 385, 11270, 1603, 712, 388, 363, 572, 114, 151, 114, 1671, 358, 3378, 815, 508, 494, 662, 508, 567, 441, 2447, 865, 6761, 713, 474, 358, 991, 2207, 387, 572, 114, 151, 114, 9673, 388, 9234, 2354, 3262, 385, 363, 10917, 9404, 865, 4799, 180, 23163, 878, 572, 114, 151, 114, 3316, 4889, 474, 363, 13297, 427, 9234, 1706, 2779, 391, 9234, 3500, 2506, 648, 14595, 865, 4751, 25411, 27626, 633, 3500, 4863, 7936, 9234, 3500, 648, 363, 26193, 8598, 387, 578, 585, 2506, 8098, 2263, 9234, 3500, 648, 1876, 385, 408, 17032, 385, 27626, 633, 1706, 2327, 32628, 1209, 938, 40287, 385, 612, 4472, 938, 6691, 385, 612, 12410, 938, 391, 20908, 491, 3207, 865, 2413, 14580, 21074, 388, 7936, 8703, 321, 439, 17192, 633, 7081, 2065, 15088, 938, 363, 25411, 3695, 938, 609, 36978, 3199, 113, 43685, 13315, 938, 21430, 2001, 456, 363, 7660, 2720, 9984, 10249, 865, 25411, 27626, 633, 3500, 4863, 7998, 3500, 33348, 30269, 452, 612, 7660, 3199, 113, 10785, 10249, 13359, 865, 1982, 2065, 16352, 1242, 363, 10917, 9404, 6342, 363, 4560, 427, 2067, 7998, 20949, 648, 792, 1599, 385, 6064, 456, 585, 651, 938, 2334, 385, 572, 114, 151, 114, 9673, 865, 5929, 321, 439, 8335, 1304, 14849, 387, 4472, 938, 911, 7660, 6142, 387, 2669, 458, 419, 1368, 37429, 576, 458, 713, 419, 1368, 2745, 746, 22125, 957, 2752, 4472, 865, 10249, 733, 5745, 427, 1667, 5929, 31082, 5885, 3129, 3786, 458, 363, 16891, 1368, 391, 42957, 458, 363, 28135, 1368, 938, 585, 582, 3621, 41492, 865, 458, 3087, 6134, 35956, 35246, 1368, 484, 1904, 388, 363, 572, 114, 151, 114, 19253, 36884, 456, 3628, 1387, 6691, 391, 9936, 4915, 6544, 430, 27748, 938, 456, 1876, 388, 358, 35246, 3087, 6134, 35956, 16352, 865, 11418, 722, 6503, 363, 9404, 456, 358, 9930, 1825, 387, 10934, 1588, 938, 441, 5084, 7075, 385, 19695, 363, 11303, 387, 1200, 1304, 36884, 865, 4751, 42498, 441, 474, 792, 933, 26772, 20240, 12564, 27351, 461, 270, 1132, 427, 5929, 651, 4372, 688, 4131, 604, 387, 12019, 865, 6480, 41526, 21947, 517, 10917, 12354, 6062, 6780, 25119, 648, 15107, 456, 7660, 2998, 458, 5448, 1368, 2471, 2745, 387, 363, 42678, 6907, 387, 10917, 4920, 938, 10249, 385, 644, 2093, 5427, 909, 8228, 8813, 938, 7660, 363, 5955, 474, 604, 387, 1731, 391, 2745, 792, 572, 114, 151, 2523, 9673, 815, 32512, 458, 363, 1282, 1368, 865, 10249, 20318, 15763, 517, 363, 572, 114, 151, 114, 419, 6941, 19005, 388, 358, 16352, 911, 2443, 1014, 1706, 21303, 7660, 3052, 10249, 490, 8025, 420, 5929, 865, 484, 1679, 1930, 490, 1784, 2443, 1014, 726, 363, 25852, 12019, 388, 5929, 458, 4943, 17689, 35246, 1368, 2413, 4314, 3058, 385, 363, 5002, 427, 363, 1679, 1930, 10884, 385, 2137, 3194, 10669, 363, 3175, 938, 23839, 517, 363, 1319, 46992, 5867, 387, 7694, 5454, 388, 5929, 865, 9777, 938, 37617, 1512, 387, 578, 4997, 6793, 385, 363, 6888, 21473, 648, 14284, 385, 363, 1395, 938, 3857, 968, 385, 13897, 938, 7660, 517, 363, 17678, 387, 363, 750, 4390, 938, 363, 1679, 1930, 6957, 363, 10917, 3874, 865, 10249, 484, 6888, 21473, 938, 9792, 391, 27991, 5104, 633, 13934, 15994, 648, 578, 3663, 385, 20588, 1706, 5454, 865, 1395, 10326, 648, 4246, 32165, 480, 363, 5986, 387, 7803, 8372, 41526, 391, 21573, 387, 363, 3823, 18759, 4372, 9557, 517, 27000, 938, 391, 12385, 427, 612, 5454, 408, 13760, 865, 871, 3353, 474, 378, 3678, 452, 427, 840, 363, 10917, 8066, 387, 24269, 938, 363, 2361, 1331, 662, 408, 1599, 385, 16798, 3316, 633, 6999, 4661, 865, 4751, 10863, 427, 7660, 5929, 2745, 474, 363, 32540, 385, 578, 387, 9234, 2354, 321, 439, 35101, 938, 576, 792, 712, 363, 4881, 6251, 840, 572, 114, 151, 3135, 12878, 37625, 597, 865, 10249, 484, 572, 114, 151, 114, 1331, 321, 439, 9673, 662, 7075, 408, 18038, 13594, 764, 5454, 391, 8383, 764, 7660, 22277, 31089, 10249, 23583, 7533, 387, 2523, 9851, 391, 3135, 18996, 648, 1074, 385, 1495, 5929, 388, 1728, 452, 572, 114, 151, 114, 4762, 865, 461, 24806, 13831, 2417, 458, 4471, 1368, 461, 270, 1132, 4822, 5929, 385, 3316, 4997, 387, 5592, 938, 4982, 938, 4587, 938, 391, 850, 2693, 363, 1679, 1930, 938, 4542, 363, 3504, 387, 7660, 1603, 391, 4472, 10249, 427, 13823, 5929, 321, 439, 49501, 865, 5929, 633, 1679, 1930, 2417, 1242, 461, 270, 1132, 321, 439, 12213, 648, 4244, 2014, 938, 3685, 440, 2641, 385, 12261, 8571, 452, 3979, 5592, 938, 4587, 938, 391, 4982, 385, 11778, 572, 114, 151, 114, 1277, 391, 4689, 865, 572, 114, 151, 114, 2093, 4078, 8543, 410, 15041, 8119, 363, 2698, 427, 461, 270, 1132, 2927, 388, 25550, 5929, 938, 2383, 7660, 23732, 746, 762, 524, 1026, 3845, 3686, 4472, 722, 363, 10917, 762, 524, 1026, 840, 363, 3763, 387, 20240, 12564, 27351, 461, 270, 1132, 2745, 458, 440, 1368, 569, 1861, 618, 430, 363, 762, 387, 5929, 722, 698, 685, 9234, 1706, 569, 1861, 430, 698, 387, 566, 762, 2263, 2745, 363, 3973, 419, 585, 862, 358, 4182, 1122, 388, 5929, 391, 7389, 23761, 441, 865, 10249, 5929, 474, 4558, 1694, 385, 572, 114, 151, 114, 1698, 5454, 391, 410, 15041, 2598, 461, 270, 1132, 456, 2095, 385, 10293, 984, 11216, 865, 410, 15041, 1239, 461, 270, 1132, 388, 1149, 420, 363, 572, 114, 151, 114, 633, 5929, 4966, 388, 41608, 938, 382, 9667, 1886, 388, 2447, 1302, 441, 474, 363, 818, 5397, 387, 358, 5687, 572, 114, 151, 114, 1994, 385, 5929, 865, 733, 474, 358, 936, 430, 363, 572, 114, 151, 114, 385, 6838, 764, 8383, 1205, 387, 461, 270, 1132, 938, 3906, 566, 20089, 2580, 865, 410, 15041, 474, 33220, 938, 2383, 7660, 457, 524, 835, 13289, 1706, 3240, 388, 5929, 427, 582, 408, 9358, 22801, 712, 461, 270, 1132, 648, 385, 4757, 391, 566, 1331, 568, 385, 5308, 865, 10249, 8046, 363, 6918, 387, 5929, 385, 572, 114, 151, 114, 1698, 5454, 391, 363, 991, 4966, 1123, 363, 835, 2779, 427, 815, 888, 363, 572, 114, 151, 114, 8927, 385, 17194, 388, 5929, 1820, 34157, 388, 363, 572, 114, 151, 114, 938, 363, 572, 114, 151, 114, 651, 7660, 358, 2207, 387, 33941, 13194, 10653, 865, 10249, 4885, 385, 631, 15707, 938, 363, 410, 15041, 3763, 321, 439, 12658, 387, 8717, 15117, 8228, 456, 14892, 7660, 3868, 363, 6862, 387, 39775, 865, 10249, 5957, 363, 12213, 387, 20240, 12564, 27351, 461, 270, 1132, 938, 5064, 33449, 523, 363, 572, 114, 151, 114, 3616, 5140, 388, 5929, 4131, 363, 5087, 387, 1913, 388, 2770, 938, 461, 114, 135, 114, 8082, 647, 10917, 9775, 865, 484, 5087, 387, 1913, 1398, 2093, 410, 15041, 387, 363, 40603, 385, 1845, 7243, 1588, 388, 5929, 938, 719, 461, 270, 1132, 474, 6007, 385, 1731, 17304, 608, 388, 3073, 3107, 387, 5929, 865, 31001, 938, 410, 15041, 851, 508, 866, 385, 22533, 576, 2328, 385, 1495, 363, 461, 270, 1132, 1331, 388, 1277, 385, 3049, 2862, 452, 1698, 2417, 1123, 363, 835, 2779, 938, 985, 456, 363, 4301, 387, 3157, 1123, 5929, 391, 363, 1679, 1930, 865, 484, 572, 114, 151, 114, 391, 363, 25626, 387, 4728, 3630, 938, 34564, 633, 35246, 458, 4471, 1368, 8875, 2809, 1159, 9469, 934, 9184, 12680, 572, 114, 151, 114, 20757, 385, 5929, 468, 114, 144, 114, 8228, 4294, 385, 7211, 363, 4046, 35246, 12193, 389, 107, 266, 184, 366, 938, 1242, 363, 9469, 934, 9184, 12680, 458, 8692, 976, 8208, 592, 258, 171, 4071, 1368, 938, 644, 34615, 1910, 6134, 415, 114, 4728, 3630, 865, 2203, 938, 363, 20757, 1345, 524, 1861, 529, 1332, 363, 8053, 7647, 387, 30349, 22146, 2093, 410, 15041, 938, 576, 20757, 8228, 651, 13760, 363, 1205, 387, 363, 3316, 13194, 16913, 388, 5929, 938, 2693, 363, 3618, 938, 2780, 938, 391, 4242, 17466, 19518, 938, 430, 363, 12193, 391, 40936, 430, 572, 114, 151, 114, 9566, 387, 363, 750, 1283, 387, 1282, 938, 3712, 12723, 10216, 468, 15674, 8427, 865, 572, 114, 151, 114, 391, 468, 15674, 8427, 7243, 35246, 633, 1579, 458, 4471, 1368, 4192, 736, 1159, 410, 797, 3814, 2584, 22144, 938, 676, 4164, 16585, 4620, 938, 391, 1679, 1930, 13856, 387, 44514, 6199, 10378, 5427, 909, 8228, 474, 14344, 49394, 1994, 388, 2906, 35246, 938, 576, 363, 12193, 389, 107, 266, 184, 366, 388, 5929, 474, 382, 5021, 1210, 938, 452, 363, 48618, 7119, 1994, 4728, 3630, 12965, 391, 566, 1742, 388, 24430, 865, 2093, 8228, 12534, 20757, 8228, 385, 2770, 391, 1669, 7029, 784, 865, 2093, 8228, 474, 32917, 480, 363, 17263, 387, 2093, 4728, 3630, 391, 11180, 2093, 451, 2980, 1879, 258, 21208, 391, 7264, 523, 991, 633, 5156, 3458, 385, 7665, 491, 26227, 25980, 851, 508, 7665, 363, 468, 15674, 8427, 456, 363, 9930, 1283, 387, 363, 10917, 1331, 865, 418, 2269, 387, 17304, 608, 6366, 604, 388, 5929, 1129, 468, 15674, 8427, 321, 439, 7243, 938, 2693, 388, 363, 2359, 458, 6396, 5900, 938, 21481, 33162, 33162, 938, 391, 1867, 12297, 10203, 1368, 938, 391, 8383, 4431, 388, 3226, 33381, 840, 44373, 10216, 36180, 1146, 865, 12202, 363, 4607, 17304, 608, 427, 4294, 2323, 4728, 3630, 385, 1277, 388, 32054, 633, 1468, 938, 5929, 23768, 757, 3127, 1276, 865, 2203, 938, 363, 9851, 387, 363, 572, 114, 151, 114, 388, 4126, 12434, 452, 764, 13194, 391, 3135, 15088, 388, 5929, 938, 3674, 3979, 5592, 391, 4587, 938, 4102, 427, 3316, 5736, 5777, 363, 936, 363, 10917, 3175, 2927, 604, 865, 1750, 572, 114, 151, 114, 6655, 5172, 427, 363, 2780, 20830, 4175, 938, 363, 676, 4164, 16585, 938, 474, 6973, 5202, 385, 468, 15674, 8427, 321, 439, 7243, 938, 2093, 8228, 6250, 6654, 385, 363, 2594, 387, 44514, 6199, 10378, 385, 2346, 363, 4175, 523, 45542, 865, 484, 572, 114, 151, 114, 851, 508, 13728, 1276, 420, 5929, 1849, 576, 363, 572, 114, 151, 114, 6654, 5382, 604, 358, 37339, 781, 1129, 468, 15674, 8427, 321, 439, 3487, 388, 44514, 6199, 10378, 865, 484, 676, 4164, 16585, 5358, 385, 23524, 480, 1295, 2594, 938, 644, 388, 39017, 13032, 8228, 865, 1651, 3136, 961, 938, 26934, 938, 10917, 2929, 388, 363, 2594, 387, 410, 797, 3814, 938, 410, 1790, 32277, 44530, 938, 5270, 358, 1549, 387, 572, 114, 151, 114, 30097, 1478, 1491, 480, 1652, 631, 2178, 523, 420, 3197, 566, 4175, 938, 391, 4246, 523, 572, 114, 151, 114, 7775, 865, 2394, 5929, 6621, 385, 16622, 388, 363, 2947, 427, 363, 572, 114, 151, 114, 651, 12385, 938, 363, 572, 114, 151, 114, 24057, 5295, 10777, 363, 2594, 387, 44514, 6199, 10378, 391, 12131, 44514, 6199, 10378, 430, 3699, 2034, 865, 5427, 909, 8228, 321, 439, 4137, 14153, 474, 566, 6328, 385, 25626, 468, 15674, 8427, 938, 4251, 440, 6621, 385, 7665, 456, 5929, 321, 439, 3655, 2263, 363, 410, 797, 3814, 2584, 22144, 851, 6859, 388, 2353, 27498, 2991, 468, 15674, 8427, 321, 439, 7243, 391, 12678, 363, 12354, 7792, 865, 484, 9839, 20769, 458, 16620, 938, 7696, 938, 391, 17557, 1368, 9378, 4212, 938, 388, 363, 44441, 18031, 4268, 4596, 938, 2815, 388, 10654, 938, 3441, 938, 391, 572, 114, 151, 114, 6654, 1465, 10917, 9361, 938, 358, 48921, 382, 29560, 387, 363, 5459, 385, 1276, 865, 32912, 1478, 24269, 458, 4471, 1368, 8875, 6786, 1159, 15544, 1911, 458, 32054, 633, 31093, 1368, 391, 6062, 6780, 25119, 38177, 1153, 3750, 1372, 387, 4966, 10308, 2004, 388, 32912, 45301, 388, 382, 11897, 387, 1706, 7775, 420, 908, 2906, 32912, 938, 719, 6134, 458, 6062, 6780, 1368, 25119, 391, 566, 4198, 387, 5424, 385, 453, 112, 931, 1551, 31259, 15040, 938, 1069, 5929, 938, 9583, 5529, 37759, 391, 47263, 7101, 865, 655, 363, 1679, 1930, 938, 25119, 1726, 385, 2481, 46661, 3786, 391, 376, 26901, 28412, 865, 26733, 387, 363, 1612, 501, 21854, 664, 34893, 1229, 478, 36723, 363, 1469, 938, 576, 1579, 5896, 391, 3579, 10481, 648, 3024, 865, 17018, 114, 5316, 114, 1858, 550, 114, 9568, 823, 3494, 8490, 358, 33053, 22918, 387, 647, 939, 112, 931, 5896, 385, 2050, 385, 8107, 25119, 865, 1220, 3478, 1468, 2034, 458, 2906, 32912, 1478, 4046, 24269, 1368, 40766, 20124, 784, 938, 1097, 585, 851, 6788, 385, 27498, 1197, 566, 3487, 865, 418, 1279, 387, 25119, 321, 439, 1454, 22677, 648, 736, 8008, 494, 3024, 1242, 363, 22918, 865, 484, 868, 501, 938, 939, 501, 938, 1468, 501, 938, 391, 1612, 501, 21854, 664, 943, 6901, 938, 819, 501, 391, 572, 114, 151, 114, 1568, 501, 27850, 3411, 6901, 938, 737, 387, 363, 572, 114, 151, 114, 819, 501, 7764, 3784, 15021, 938, 391, 6594, 4948, 12707, 363, 4966, 757, 5929, 388, 3196, 113, 16293, 938, 4041, 1669, 517, 363, 743, 501, 21854, 664, 938, 1697, 501, 391, 2088, 501, 27850, 35689, 458, 1679, 1930, 1368, 938, 391, 12050, 391, 685, 5092, 865, 9568, 823, 474, 2527, 385, 6367, 644, 2773, 784, 385, 2562, 363, 18683, 387, 5929, 938, 391, 474, 2353, 49287, 517, 363, 1210, 427, 363, 10917, 1331, 391, 762, 682, 4815, 363, 11897, 865, 25271, 4948, 387, 363, 22918, 41948, 456, 1391, 456, 2648, 1474, 938, 718, 7438, 4709, 458, 33860, 10672, 1368, 5467, 387, 363, 4966, 938, 576, 25119, 474, 1340, 8008, 865, 484, 2024, 20055, 7626, 387, 9365, 387, 15857, 15031, 37339, 5715, 452, 1503, 11861, 387, 31723, 865, 1419, 648, 873, 21123, 452, 10917, 5508, 5092, 2263, 363, 850, 2827, 474, 420, 2411, 2896, 32912, 480, 363, 5939, 387, 1980, 47948, 383, 938, 911, 358, 43026, 387, 363, 939, 501, 21854, 664, 474, 3117, 6673, 865, 1911, 662, 2293, 524, 688, 6976, 576, 430, 363, 4789, 3175, 388, 2132, 865, 3513, 624, 938, 9927, 363, 2205, 3319, 5529, 474, 3051, 938, 391, 850, 387, 363, 2452, 5033, 651, 688, 2818, 1244, 391, 17399, 420, 363, 4966, 979, 363, 987, 387, 363, 14770, 865, 14536, 2417, 452, 5929, 648, 15133, 4292, 517, 13194, 24563, 938, 391, 363, 6654, 648, 23120, 523, 5929, 388, 4046, 24269, 865, 25960, 1478, 31093, 458, 4471, 1368, 8875, 2809, 1159, 5939, 387, 1804, 39666, 500, 620, 2141, 15468, 21123, 452, 10917, 4274, 2402, 478, 1046, 938, 456, 981, 456, 10917, 35190, 2141, 938, 3868, 385, 17138, 363, 572, 114, 151, 114, 633, 10917, 4966, 523, 24269, 385, 31093, 865, 5001, 363, 19027, 9139, 50304, 14770, 387, 3370, 24269, 851, 508, 1186, 385, 358, 1378, 572, 114, 151, 114, 9673, 938, 441, 1819, 1396, 1129, 363, 26474, 387, 363, 26841, 11781, 391, 38438, 15834, 1123, 363, 5017, 391, 5929, 865, 12943, 40689, 1819, 1396, 1575, 448, 619, 28442, 12624, 938, 6396, 5900, 938, 420, 453, 3527, 24269, 2263, 388, 3087, 35781, 22200, 938, 21481, 33162, 33162, 938, 420, 2709, 3527, 24269, 2263, 1575, 4790, 2003, 48073, 938, 4037, 938, 420, 961, 3370, 25960, 2263, 480, 12794, 3666, 938, 5929, 938, 647, 2680, 2906, 25960, 2263, 480, 363, 3341, 387, 500, 620, 2141, 420, 363, 6396, 5900, 1478, 8044, 4966, 420, 2782, 3033, 25960, 2263, 391, 1575, 2675, 39346, 938, 4037, 938, 420, 1568, 2896, 31093, 865, 10917, 1911, 4910, 2024, 2038, 2483, 8809, 37670, 388, 5929, 458, 4471, 1368, 12789, 387, 6062, 6780, 25119, 321, 439, 1706, 15879, 387, 21172, 4751, 36944, 938, 1506, 1029, 1048, 391, 2131, 1866, 48417, 523, 2455, 5929, 648, 12826, 517, 363, 23337, 14168, 391, 19762, 387, 363, 10917, 9404, 865, 4143, 37670, 5084, 388, 18938, 5462, 388, 363, 5194, 387, 5929, 938, 11577, 881, 984, 3107, 648, 363, 11807, 385, 3069, 5827, 2274, 385, 5929, 523, 363, 572, 114, 151, 114, 938, 391, 11577, 881, 6062, 6780, 25119, 651, 746, 653, 4676, 647, 13066, 37670, 865, 484, 818, 41554, 387, 3316, 37670, 938, 1242, 363, 32054, 4728, 3630, 27461, 938, 474, 363, 9697, 959, 491, 22447, 5784, 2697, 174, 27599, 458, 8809, 1481, 25887, 188, 1368, 938, 644, 3118, 8219, 2005, 27869, 458, 7660, 2732, 482, 2980, 10249, 1368, 12923, 923, 37667, 938, 31946, 387, 363, 28432, 8301, 656, 7584, 938, 456, 981, 456, 968, 1706, 23197, 865, 11551, 938, 1242, 363, 27461, 1129, 363, 12193, 389, 107, 266, 184, 366, 387, 12723, 10216, 468, 15674, 8427, 938, 968, 387, 363, 1077, 19771, 391, 1955, 648, 18875, 391, 30267, 517, 6062, 6780, 25119, 391, 566, 4878, 23368, 276, 178, 1720, 5515, 761, 865, 25119, 18875, 3500, 938, 14109, 391, 685, 19771, 387, 578, 9904, 523, 2930, 21649, 3754, 420, 611, 938, 576, 363, 850, 4148, 37869, 391, 1367, 3533, 648, 4673, 2586, 6255, 985, 456], "start_token": 407, "end_token": 411, "category": 1}
|
{"input_ids": [65, 386, 1170, 7591, 3655, 609, 474, 4956, 517, 363, 16604, 2686, 1242, 386, 1170, 7591, 3127, 1276, 66, 321, 439, 14044, 3217, 46542, 574, 48926, 5083, 7025, 391, 5276, 4537, 16913, 865, 1419, 419, 1411, 4820, 427, 25119, 321, 439, 10917, 7649, 387, 363, 4242, 8809, 15879, 458, 2001, 456, 363, 7660, 15879, 387, 21172, 10249, 1368, 474, 382, 1694, 5867, 388, 25119, 321, 439, 23783, 1129, 468, 15674, 8427, 321, 439, 5719, 5508, 865, 572, 114, 151, 114, 2523, 39112, 458, 4471, 1368, 10917, 4910, 9165, 484, 572, 114, 151, 114, 2523, 11444, 363, 10917, 4910, 9165, 385, 764, 6654, 430, 2240, 388, 5929, 865, 484, 2038, 2483, 419, 7973, 452, 358, 4272, 3742, 39959, 391, 358, 7236, 4178, 39959, 420, 1224, 5844, 865, 484, 4178, 391, 7973, 16966, 363, 7679, 36382, 3311, 5382, 480, 363, 5939, 387, 19841, 489, 7113, 388, 453, 31312, 938, 644, 5382, 358, 3970, 4353, 11292, 517, 363, 4178, 559, 8240, 387, 363, 728, 23874, 383, 865, 484, 4272, 3225, 578, 8502, 385, 363, 1679, 1930, 5508, 391, 10330, 385, 363, 15439, 29174, 27360, 5929, 523, 363, 1679, 1930, 865, 4192, 736, 458, 4471, 1368, 10917, 9404, 5929, 633, 1679, 1930, 2417, 11923, 458, 4471, 1368, 10664, 16004, 611, 385, 1159, 46200, 36391, 938, 484, 4044, 1911, 388, 5929, 1159, 2132, 938, 363, 1679, 1930, 938, 391, 363, 10917, 9404, 865, 4943, 1159, 2160, 387, 4943, 4433, 14846, 938, 380, 114, 321, 46673, 865, 16004, 611, 10664, 2739, 1479, 2604, 114, 8469, 6596, 114, 886, 115, 361, 8024, 396, 118, 115, 1151, 13311, 822, 17310, 1170, 3814, 115, 118, 114, 6595, 16004, 611, 10664, 2739, 1479, 2604, 114, 22641, 1777, 16725, 114, 886, 115, 45532, 113, 137, 13355, 33640, 115, 17222, 113, 32535, 113, 152, 15041, 113, 33717, 113, 2102, 3569, 114, 6595, 10664, 16004, 611, 385, 1159, 2739, 1479, 177, 4766, 16260, 114, 2499, 115, 22641, 115, 184, 15041, 115, 509, 693, 115, 8583, 4968, 115, 121, 16004, 611, 10664, 2739, 1479, 3627, 6158, 570, 1089, 114, 886, 115, 3627, 6158, 115, 2819, 25641, 115, 669, 113, 16471, 113, 6839, 113, 25445, 113, 1270, 113, 177, 1170, 7591, 113, 32344, 113, 1230, 1586, 113, 40555, 16004, 611, 10664, 1858, 471, 397, 542, 938, 7605, 865, 7660, 484, 10917, 9404, 10249, 388, 5929, 4720, 20254, 938, 1326, 865, 27010, 5248, 12859, 865, 14558, 1159, 14558, 2160, 4433, 10350, 938, 380, 114, 23235, 865, 16004, 611, 10664, 36391, 938, 4044, 1911, 388, 5929, 938, 380, 114, 743, 2515, 865, 16004, 611, 10664, 10019, 938, 3041, 865, 428, 114, 7660, 1968, 321, 439, 385, 1456, 24530, 2181, 806, 2396, 5734, 5483, 387, 10917, 23998, 35684, 12479, 1209, 938, 42419, 7677, 20698, 391, 39121, 4381, 7957, 4085, 388, 363, 1679, 1930, 4433, 35246, 633, 32163, 10249, 938, 10917, 10523, 938, 10734, 4810, 114, 1579, 938, 1501, 114, 453, 458, 7896, 1368, 1159, 1643, 865, 16004, 611, 10664, 10019, 938, 3041, 865, 428, 114, 7660, 1968, 321, 439, 385, 1456, 24530, 2181, 806, 2396, 5734, 5483, 387, 10917, 23998, 35684, 12479, 1209, 938, 42419, 7677, 20698, 391, 39121, 4381, 7957, 4085, 388, 363, 1679, 1930, 4433, 35246, 633, 32163, 10249, 938, 10917, 10523, 938, 10734, 4810, 114, 1579, 938, 1501, 114, 453, 458, 8410, 1368, 1159, 2680, 865, 16004, 611, 10664, 7861, 1018, 418, 114, 2648, 37608, 938, 7660, 484, 24180, 387, 12398, 113, 24771, 7591, 11453, 3782, 388, 363, 1679, 1930, 10249, 938, 1069, 11814, 4810, 114, 819, 458, 15690, 1368, 1159, 23767, 938, 24164, 16004, 611, 10664, 10019, 938, 3041, 865, 428, 114, 7660, 1968, 321, 439, 385, 1456, 24530, 2181, 806, 2396, 5734, 5483, 387, 10917, 23998, 35684, 12479, 1209, 938, 42419, 7677, 20698, 391, 39121, 4381, 7957, 4085, 388, 363, 1679, 1930, 4433, 35246, 633, 32163, 10249, 938, 10917, 10523, 938, 10734, 4810, 114, 1579, 938, 1501, 114, 453, 458, 8410, 1368, 1159, 2782, 633, 2680, 938, 736, 2001, 456, 363, 40763, 7539, 3270, 46885, 865, 16004, 611, 10664, 7861, 1018, 418, 114, 2648, 37608, 938, 7660, 484, 24180, 387, 12398, 113, 24771, 7591, 11453, 3782, 388, 363, 1679, 1930, 10249, 938, 1069, 11814, 4810, 114, 819, 458, 15690, 1368, 1159, 12814, 865, 16004, 611, 10664, 10019, 938, 3041, 865, 428, 114, 7660, 1968, 321, 439, 385, 1456, 24530, 2181, 806, 2396, 5734, 5483, 387, 10917, 23998, 35684, 12479, 1209, 938, 42419, 7677, 20698, 391, 39121, 4381, 7957, 4085, 388, 363, 1679, 1930, 4433, 35246, 633, 32163, 10249, 938, 10917, 10523, 938, 10734, 4810, 114, 1579, 938, 1501, 114, 453, 458, 7896, 1368, 1159, 1643, 633, 3362, 865, 16004, 611, 10664, 1858, 418, 114, 1810, 47405, 938, 7660, 418, 11241, 430, 30664, 10249, 388, 9404, 391, 16815, 1536, 1159, 5483, 387, 363, 10917, 9404, 388, 363, 1679, 1930, 865, 11968, 1159, 484, 2160, 4433, 387, 11968, 458, 8836, 1368, 1159, 2909, 865, 10664, 16004, 611, 385, 1159, 1810, 47405, 938, 1858, 865, 418, 114, 7660, 9404, 388, 30633, 10249, 388, 9404, 391, 16815, 1536, 1159, 5483, 387, 363, 10917, 9404, 388, 363, 1679, 1930, 865, 11968, 1159, 484, 2160, 4433, 387, 11968, 458, 8836, 1368, 1159, 743, 865, 16004, 611, 10664, 10019, 938, 3041, 865, 428, 114, 7660, 1968, 321, 439, 385, 1456, 24530, 2181, 806, 2396, 5734, 5483, 387, 10917, 23998, 35684, 12479, 1209, 938, 42419, 7677, 20698, 391, 39121, 4381, 7957, 4085, 388, 363, 1679, 1930, 4433, 35246, 633, 32163, 10249, 938, 10917, 10523, 938, 10734, 4810, 114, 1579, 938, 1501, 114, 453, 458, 8410, 1368, 1159, 2420, 865, 16004, 611, 10664, 10019, 938, 3041, 865, 428, 114, 7660, 1968, 321, 439, 385, 1456, 24530, 2181, 806, 2396, 5734, 5483, 387, 10917, 23998, 35684, 12479, 1209, 938, 42419, 7677, 20698, 391, 39121, 4381, 7957, 4085, 388, 363, 1679, 1930, 4433, 35246, 633, 32163, 10249, 938, 10917, 10523, 938, 10734, 4810, 114, 1579, 938, 1501, 114, 453, 458, 7896, 1368, 1159, 2420, 633, 6174, 865, 16004, 611, 10664, 24517, 938, 24124, 503, 114, 391, 472, 2619, 418, 114, 39793, 865, 7660, 8166, 391, 363, 24180, 387, 410, 20064, 19336, 13742, 37092, 523, 5929, 385, 363, 1679, 1930, 10249, 388, 418, 13742, 387, 21481, 35591, 7544, 938, 1069, 2072, 938, 39703, 3066, 458, 5917, 1368, 1159, 5315, 865, 16004, 611, 10664, 24517, 938, 24124, 503, 114, 391, 472, 2619, 418, 114, 39793, 865, 7660, 8166, 391, 363, 24180, 387, 410, 20064, 19336, 13742, 37092, 523, 5929, 385, 363, 1679, 1930, 10249, 388, 418, 13742, 387, 21481, 35591, 7544, 938, 1069, 2072, 938, 39703, 3066, 458, 5917, 1368, 1159, 3362, 865, 16004, 611, 10664, 1810, 47405, 938, 1858, 865, 418, 114, 7660, 9404, 388, 30633, 10249, 388, 9404, 391, 16815, 1536, 1159, 5483, 387, 363, 10917, 9404, 388, 363, 1679, 1930, 865, 11968, 1159, 484, 2160, 4433, 387, 11968, 458, 8836, 1368, 1159, 819, 865, 16004, 611, 10664, 24517, 938, 24124, 503, 114, 391, 472, 2619, 418, 114, 39793, 865, 7660, 8166, 391, 363, 24180, 387, 410, 20064, 19336, 13742, 37092, 523, 5929, 385, 363, 1679, 1930, 10249, 388, 418, 13742, 387, 21481, 35591, 7544, 938, 1069, 2072, 938, 39703, 3066, 458, 5917, 1368, 1159, 3540, 938, 12577, 6265, 865, 16004, 611, 10664, 1810, 47405, 938, 1858, 865, 418, 114, 7660, 9404, 388, 30633, 10249, 388, 9404, 391, 16815, 1536, 1159, 5483, 387, 363, 10917, 9404, 388, 363, 1679, 1930, 865, 11968, 1159, 484, 2160, 4433, 387, 11968, 458, 8836, 1368, 1159, 908, 865, 10664, 16004, 611, 385, 1159, 36391, 938, 484, 4044, 1911, 388, 5929, 865, 16004, 611, 10664, 11048, 388, 31340, 412, 6780, 22251, 938, 1456, 13826, 363, 1679, 1930, 1159, 418, 7544, 387, 572, 114, 151, 114, 7921, 410, 46239, 9234, 2354, 865, 14558, 1159, 11232, 2160, 4433, 7896, 938, 9889, 114, 34486, 633, 4454, 865, 10664, 16004, 611, 385, 1159, 412, 6780, 22251, 938, 1456, 13826, 363, 1679, 1930, 938, 380, 114, 32645, 865, 16004, 611, 10664, 2739, 1479, 33732, 23670, 114, 10856, 114, 886, 115, 476, 115, 38572, 2133, 1046, 48205, 183, 115, 180, 115, 186, 8708, 6199, 10378, 114, 19312, 31559, 458, 4471, 1368, 10019, 938, 3041, 865, 428, 114, 7660, 1968, 321, 439, 385, 1456, 24530, 2181, 806, 2396, 5734, 5483, 387, 10917, 23998, 35684, 12479, 1209, 938, 42419, 7677, 20698, 391, 39121, 4381, 7957, 4085, 388, 363, 1679, 1930, 4433, 35246, 633, 32163, 10249, 938, 10917, 10523, 938, 10734, 4810, 114, 1579, 938, 1501, 114, 453, 458, 7896, 1368, 1159, 2343, 633, 4418, 865, 1810, 47405, 938, 1858, 865, 418, 865, 7660, 418, 11241, 430, 30664, 10249, 388, 9404, 391, 16815, 1536, 1159, 5483, 387, 363, 10917, 9404, 388, 363, 1679, 1930, 865, 11968, 1159, 484, 2160, 4433, 387, 11968, 458, 8836, 1368, 1159, 1780, 633, 5226, 865, 1810, 47405, 938, 1858, 865, 418, 114, 7660, 9404, 388, 30633, 10249, 388, 9404, 391, 16815, 1536, 1159, 5483, 387, 363, 10917, 9404, 388, 363, 1679, 1930, 865, 11968, 1159, 484, 2160, 4433, 387, 11968, 458, 8836, 1368, 1159, 743, 633, 2343, 865, 24517, 938, 24124, 503, 114, 391, 472, 2619, 418, 114, 39793, 865, 7660, 8166, 391, 363, 24180, 387, 410, 20064, 19336, 13742, 37092, 523, 5929, 385, 363, 1679, 1930, 10249, 388, 418, 13742, 387, 21481, 35591, 7544, 938, 1069, 2072, 938, 39703, 3066, 458, 5917, 1368, 1159, 2909, 633, 6236, 865, 2648, 37608, 938, 7861, 1018, 418, 865, 7660, 484, 24180, 387, 12398, 113, 24771, 7591, 11453, 3782, 388, 363, 1679, 1930, 10249, 938, 1069, 11814, 4810, 114, 819, 458, 15690, 1368, 1159, 23767, 633, 26219, 865, 34680, 6218, 458, 4471, 1368, 28280, 387, 20526, 388, 363, 10917, 9404, 1679, 1930, 9673, 388, 9234, 2354, 7921, 26350, 35642, 458, 1349, 2055, 1368, 1446, 1179, 8542, 458, 40024, 1478, 8803, 1368, 19398, 1867, 2588, 661, 1321, 4504, 23095, 13060, 458, 43886, 1368, 4700, 28809, 2551, 458, 26640, 1368, 29848, 25583, 40159, 6277, 6277, 10917, 1478, 1706, 1911, 458, 1349, 3611, 1478, 4865, 1368, 7998, 1478, 1706, 1911, 458, 46345, 1368, 15544, 1911, 458, 32054, 1478, 779, 1368, 1679, 1930, 9851, 388, 363, 10917, 9404, 458, 32912, 1478, 779, 1368, 46168, 4129, 391, 23409, 451, 30068, 30207, 22918, 458, 1349, 3466, 1368, 3375, 15328, 442, 387, 14260, 458, 47566, 1478, 45712, 1368, 23620, 1478, 21392, 14240, 391, 9176, 1478, 28616, 660, 633, 12473, 5150, 21446, 458, 41726, 1368, 5599, 15328, 442, 387, 14260, 458, 40639, 1478, 7870, 1368, 48328, 387, 33083, 15328, 442, 387, 38353, 458, 34564, 1478, 4848, 1368, 15328, 442, 387, 44514, 6199, 10378, 458, 26934, 1368, 15328, 442, 387, 25152, 458, 32163, 1478, 5075, 1368, 15328, 442, 387, 363, 32123, 2167, 458, 32912, 1478, 2088, 1368, 15328, 442, 387, 363, 32123, 2167, 458, 17773, 1478, 8031, 1368, 25585, 387, 19775, 4864, 458, 13641, 1368, 25585, 387, 23620, 458, 11205, 1368, 1867, 1952, 4129, 24819, 28272, 25887, 12193, 389, 107, 266, 184, 366, 4797, 387, 49311, 25585, 458, 20611, 1368, 14781, 25101, 11331, 14159, 5036, 321, 39090, 12574, 27835, 15775, 48115, 12193, 389, 107, 266, 184, 366, 3268, 17229, 3768, 6345, 34598, 12193, 389, 107, 266, 184, 366, 2331, 5573, 48824, 21641, 3920, 18248, 25451, 18761, 458, 20134, 1368, 1679, 1930, 9851, 388, 7243, 1588, 388, 9234, 2354, 8809, 2551, 387, 363, 1679, 1930, 9234, 2354, 1478, 1679, 1930, 2417, 10917, 9404, 25454, 7544, 387, 5929, 11380, 7544, 387, 5929, 14812, 12854, 35725, 468, 32110, 35725, 428, 40298, 2020, 1181, 8066, 387, 1349, 3654, 17994, 1911, 4790, 898, 1741, 2712, 4242, 43774, 388, 5929, 451, 24364, 14884, 5650, 428, 1254, 270, 12564, 7067, 28612, 762, 20240, 12564, 27351, 461, 270, 1132, 6134, 415, 114, 4728, 3630, 12723, 10216, 468, 15674, 8427, 6134, 7660, 6062, 6780, 10249, 25119, 10033, 537, 10216, 20866, 35920, 44373, 10216, 36180, 1146, 321, 226, 6881, 12123, 1936, 2402, 276, 178, 38948, 40323, 3045, 276, 178, 451, 3473, 824, 1572, 8691, 1174, 451, 2391, 18971, 1174, 2675, 270, 393, 2300, 930, 507, 258, 190, 12123, 428, 258, 182, 3035, 24817, 22669, 266, 676, 1259, 7677, 516, 555, 7532, 276, 178, 2845, 1474, 6134, 1105, 276, 178, 491, 8692, 2510, 531, 477, 266, 176, 945, 461, 270, 1132, 8117, 22022, 1174, 6307, 13210, 40700, 513, 3147, 469, 1053, 36180, 1146, 26096, 451, 6182, 12893, 5316, 760, 13139, 491, 8692, 541, 12425, 772, 8948, 30406, 5325, 387, 3087, 20995, 451, 14264, 270, 5325, 387, 13810, 6182, 5325, 387, 2063, 31783, 48823, 5325, 387, 2550, 6514, 4490, 17268, 5325, 387, 3087, 9601, 14712, 13413, 21446, 387, 428, 16216, 48085, 12686, 258, 21208, 4381, 8208, 592, 258, 171, 4071, 11781, 387, 33219, 3473, 42791, 4980, 1296, 15674, 266, 184, 12123, 26841, 11781, 6062, 6780, 25119, 38177, 39063, 5650, 1679, 1930, 9851, 5279, 703, 14944, 2396, 4355, 523, 5929, 10917, 8066, 387, 24269, 24669, 3630, 1911, 6480, 898, 24015, 10917, 33393, 16064, 13714, 1142, 42090, 22724, 4069, 23222, 9695, 33176, 385, 363, 9404, 2363, 5778, 28206, 3716, 458, 451, 7213, 1368, 44311, 8172, 12624, 5508, 387, 2452, 29336, 40767, 8625, 13471, 3716, 387, 363, 10917, 9404, 3920, 43141, 477, 4759, 29336, 5508, 387, 363, 2621, 4858, 371, 416, 32893, 20814, 35190, 2141, 5553, 778, 37604, 438, 1941, 37604, 43125, 523, 7660, 3841, 1479, 369, 114, 31367, 114, 2499, 115, 187, 115, 9731, 114, 10222, 131, 7940, 129, 17114, 163, 42338, 163, 360, 13139, 6881, 1073, 163, 360, 163, 1270, 163, 24771, 7591, 163, 50338, 106, 450, 20940, 129, 48735, 24237, 27134, 10249, 45587, 1159, 10917, 9404, 40159, 6277, 32912, 388, 5929, 5929, 1478, 1679, 1930, 2417, 20559, 9477, 1159, 1540, 6786, 452, 5677, 30656, 6400, 22799, 452, 5677, 30656, 6400, 523, 2896, 1954, 12268, 26815, 8095, 15413, 4448, 45385, 267, 183, 5413, 6218, 871, 2544, 474, 1039, 13113, 420, 1643, 2906, 2965, 938, 480, 3672, 1159, 6174, 865, 8356, 419, 1796, 840, 363, 17505, 13916, 45437, 633, 8835, 133, 2440, 13890, 2263, 3325, 2947, 844, 4275, 865, 2851, 1363, 529, 2625, 938, 446, 4337, 385, 363, 17738, 387, 5866, 391, 16878, 7921, 865, 15413, 321, 207, 419, 358, 6924, 16129, 387, 363, 44978, 5794, 938, 3558, 114, 938, 358, 1830, 113, 9284, 4110, 865, 8095, 15413, 66], "start_token": -100, "end_token": -100, "category": 0}
|
{"input_ids": [65, 911, 419, 363, 15086, 2095, 420, 358, 389, 796, 13325, 66, 12344, 2095, 633, 321, 31367, 12344, 2095, 16004, 385, 1159, 16509, 938, 3090, 7660, 321, 50092, 5037, 10249, 475, 13841, 8445, 1013, 1095, 865, 1215, 363, 2157, 1731, 938, 867, 6444, 7074, 865, 1215, 685, 3645, 938, 867, 321, 50092, 865, 12344, 1321, 321, 50092, 2095, 420, 4318, 10687, 484, 12344, 2095, 387, 358, 3745, 10687, 10330, 385, 7264, 358, 674, 16707, 10450, 391, 21074, 452, 779, 501, 4390, 3458, 865, 655, 3761, 8849, 938, 363, 2095, 569, 746, 981, 633, 5548, 4108, 938, 576, 1082, 529, 419, 363, 1440, 938, 441, 561, 408, 1074, 517, 3889, 430, 3085, 25774, 8962, 938, 985, 456, 385, 5179, 1123, 3395, 17695, 11092, 938, 385, 23755, 358, 1531, 938, 494, 385, 11414, 358, 38154, 4738, 865, 4463, 363, 2371, 2264, 419, 3322, 6030, 452, 363, 15086, 2264, 420, 631, 2095, 1302, 363, 9894, 387, 363, 19865, 9205, 438, 9050, 633, 2095, 10687, 388, 12964, 938, 363, 12344, 2095, 419, 736, 1545, 363, 321, 50092, 2095, 865, 733, 561, 408, 1074, 385, 15086, 718, 3745, 1931, 865, 26815, 458, 7909, 1368, 453, 7544, 463, 35028, 614, 7924, 4628, 705, 12596, 34613, 743, 7484, 12922, 1332, 12344, 2095, 819, 29667, 430, 7264, 363, 1531, 321, 439, 9807, 868, 31559, 908, 4192, 736, 7544, 458, 4471, 1368, 418, 3311, 674, 16707, 10450, 20518, 578, 363, 8352, 938, 624, 41217, 391, 13692, 388, 358, 2161, 2269, 9153, 865, 6761, 363, 624, 41217, 820, 5086, 792, 719, 1212, 8352, 490, 967, 458, 4939, 938, 736, 2001, 456, 7660, 18831, 10249, 1478, 807, 363, 16983, 8950, 1026, 420, 3449, 9255, 517, 2004, 13671, 674, 1556, 2517, 12095, 1368, 865, 1507, 363, 6565, 10189, 569, 385, 1846, 612, 2095, 967, 494, 2070, 358, 3271, 633, 388, 528, 24808, 5179, 388, 1603, 385, 1410, 363, 685, 10189, 3859, 865, 1182, 358, 13022, 938, 363, 6565, 10189, 815, 11414, 363, 7317, 10189, 517, 4857, 612, 2095, 938, 7264, 363, 10450, 391, 10934, 441, 757, 358, 7660, 31151, 10249, 4107, 865, 5848, 624, 41217, 2346, 14510, 385, 363, 29889, 321, 439, 986, 1213, 938, 321, 36314, 990, 363, 29889, 865, 458, 418, 3619, 2371, 388, 363, 674, 16707, 1728, 662, 524, 363, 1077, 1346, 865, 1368, 484, 5836, 1151, 3950, 12329, 388, 358, 946, 2193, 7078, 2946, 427, 363, 7317, 4530, 4131, 363, 9153, 4939, 458, 9257, 453, 938, 494, 7660, 18831, 10249, 1368, 873, 1242, 1891, 37723, 1123, 3536, 865, 31804, 967, 358, 2142, 7660, 2371, 10249, 2095, 4822, 363, 9153, 938, 10934, 441, 757, 358, 13049, 9257, 758, 938, 494, 7660, 31151, 10249, 938, 4107, 865, 1750, 529, 5192, 938, 363, 5836, 1151, 3950, 11802, 17552, 820, 6706, 1332, 13671, 2098, 938, 456, 363, 578, 633, 758, 183, 2196, 419, 363, 1830, 113, 180, 12870, 990, 500, 6340, 388, 1212, 448, 660, 26619, 391, 37202, 865, 484, 7287, 7939, 1493, 363, 7317, 10189, 321, 439, 3342, 865, 871, 3458, 5382, 726, 385, 5836, 1151, 3950, 880, 420, 741, 633, 7474, 9162, 865, 418, 13049, 31151, 458, 12320, 758, 1368, 4107, 21907, 363, 3997, 427, 891, 5039, 2196, 569, 385, 987, 452, 631, 494, 618, 9257, 453, 458, 18831, 1368, 7660, 2346, 10249, 10441, 865, 484, 3745, 458, 5835, 363, 572, 7328, 1368, 8119, 529, 456, 358, 2142, 7660, 2371, 10249, 4107, 391, 7661, 382, 11414, 427, 6133, 5126, 358, 2592, 1531, 494, 4238, 363, 5462, 1181, 385, 6253, 430, 358, 17695, 865, 5001, 39455, 11490, 5836, 46885, 6984, 419, 884, 4172, 938, 363, 12344, 2095, 1853, 1074, 452, 12195, 896, 24426, 561, 1092, 408, 1074, 517, 3889, 430, 2193, 5060, 865, 35028, 458, 4471, 1368, 1651, 363, 35028, 321, 40793, 1896, 391, 321, 40793, 6760, 9162, 938, 363, 12344, 419, 17636, 517, 12374, 4788, 865, 1651, 363, 35028, 321, 40793, 27318, 441, 419, 17636, 517, 23635, 15677, 1444, 4788, 865, 484, 27318, 111, 391, 1669, 9162, 524, 358, 7357, 12344, 2095, 865, 733, 958, 508, 7717, 382, 11414, 576, 582, 17470, 698, 2592, 29910, 2250, 1531, 938, 494, 23755, 363, 11147, 494, 9015, 387, 1467, 385, 42913, 9255, 865, 1153, 19173, 29910, 2250, 1531, 561, 3322, 408, 28392, 452, 363, 43760, 9025, 3242, 865, 484, 35028, 321, 9812, 3745, 938, 1332, 358, 12344, 2095, 938, 8840, 363, 2264, 385, 19313, 1444, 4788, 865, 7924, 4628, 458, 4471, 1368, 1651, 358, 7924, 4628, 3745, 938, 363, 12344, 2095, 18717, 358, 6991, 13360, 644, 662, 7786, 2829, 358, 5915, 15866, 387, 363, 3745, 865, 418, 4793, 15866, 419, 14074, 517, 12374, 19313, 1444, 12344, 865, 1103, 358, 12281, 1181, 419, 6690, 938, 321, 100, 15677, 1444, 12344, 582, 2829, 363, 3745, 385, 3090, 430, 391, 3541, 494, 1158, 358, 2494, 1545, 5246, 18993, 420, 363, 12281, 1181, 321, 439, 4378, 3436, 458, 405, 114, 171, 114, 49516, 11999, 758, 938, 3228, 2937, 16595, 2495, 1368, 865, 484, 6947, 835, 39076, 648, 19653, 517, 363, 17371, 385, 418, 20873, 438, 2741, 938, 472, 37820, 7395, 865, 2413, 39076, 815, 408, 3522, 494, 22213, 388, 3889, 938, 391, 648, 1791, 1074, 388, 47482, 3199, 113, 8804, 7706, 865, 12596, 34613, 458, 4471, 1368, 1651, 968, 3761, 21970, 938, 321, 50092, 48338, 3260, 5173, 517, 27654, 1667, 1295, 2095, 419, 12171, 865, 871, 419, 4151, 1242, 6398, 388, 2521, 4336, 391, 388, 358, 43137, 3192, 388, 4065, 3439, 4336, 452, 2127, 4052, 865, 1651, 2004, 34613, 1332, 358, 321, 50092, 2095, 458, 979, 363, 9894, 387, 9050, 1321, 15244, 633, 2095, 34613, 1368, 363, 321, 50092, 2264, 474, 8787, 385, 19313, 1444, 31936, 25493, 938, 391, 363, 12344, 2264, 385, 19313, 1444, 412, 6199, 25493, 2263, 878, 2095, 633, 17891, 1092, 771, 452, 850, 4157, 938, 873, 420, 3761, 21970, 452, 3761, 34613, 865, 451, 11798, 363, 7357, 321, 50092, 2095, 420, 9050, 1321, 15244, 633, 2095, 34613, 12901, 363, 1077, 9468, 40249, 456, 12374, 19313, 938, 889, 31936, 25493, 938, 889, 13112, 707, 388, 363, 9676, 1603, 662, 567, 2263, 36628, 938, 382, 513, 117, 21332, 419, 2009, 938, 644, 13637, 9050, 1321, 15244, 633, 2095, 633, 4011, 3889, 385, 22125, 363, 835, 7546, 938, 1082, 4798, 3889, 3322, 756, 24346, 363, 21332, 865, 484, 321, 50092, 2095, 419, 1281, 523, 578, 685, 8352, 388, 427, 441, 12901, 746, 9468, 40249, 480, 578, 420, 2751, 2263, 4462, 441, 419, 508, 1845, 430, 698, 3889, 385, 5105, 1872, 529, 2095, 419, 953, 2815, 967, 865, 1651, 3761, 34613, 938, 363, 12344, 2095, 419, 3322, 15595, 321, 50092, 452, 12344, 2275, 938, 3461, 11367, 517, 358, 1728, 938, 494, 321, 50092, 420, 363, 1454, 387, 363, 2095, 11229, 391, 12344, 420, 363, 2267, 865, 655, 850, 4065, 12594, 938, 363, 2095, 6188, 321, 100, 7279, 1444, 321, 50092, 6875, 611, 363, 1181, 6709, 865, 7484, 12922, 1332, 12344, 2095, 458, 4471, 1368, 38005, 391, 21023, 34613, 1791, 567, 508, 524, 358, 7357, 321, 50092, 1321, 12344, 2095, 865, 2413, 844, 880, 363, 1809, 44335, 430, 12344, 1159, 19313, 1444, 37582, 1444, 477, 1258, 494, 37582, 1444, 448, 494, 37582, 1444, 19313, 1444, 448, 420, 1829, 40370, 26736, 391, 1829, 23718, 26736, 865, 37582, 1444, 16420, 420, 10498, 865, 19313, 1444, 37582, 1444, 321, 100, 15677, 420, 1829, 6675, 26736, 865, 25045, 16946, 430, 321, 50092, 1159, 37582, 1444, 451, 494, 37582, 1444, 19313, 1444, 451, 494, 37582, 1444, 12445, 1444, 451, 458, 420, 1829, 40370, 26736, 1368, 865, 37582, 1444, 321, 100, 15677, 420, 1829, 6675, 26736, 865, 4297, 34613, 567, 508, 524, 363, 321, 50092, 1321, 12344, 2095, 938, 456, 4201, 7395, 1496, 958, 508, 880, 441, 865, 484, 2095, 844, 408, 31702, 517, 37582, 1444, 16420, 1215, 23718, 26736, 1332, 358, 12344, 2095, 1904, 363, 321, 31530, 1444, 4788, 2419, 391, 3023, 7660, 4326, 3723, 10249, 865, 29667, 430, 7264, 363, 1531, 321, 439, 9807, 458, 4471, 1368, 2994, 1212, 19313, 1444, 12344, 391, 19313, 1444, 428, 6188, 490, 8912, 9278, 456, 358, 936, 387, 7264, 363, 9807, 387, 358, 8725, 3687, 938, 585, 490, 736, 1074, 430, 2193, 1346, 388, 11622, 2579, 12594, 865, 5001, 878, 835, 490, 1791, 3278, 43716, 938, 653, 34494, 391, 9807, 12594, 3322, 8434, 1281, 10526, 385, 878, 865, 12133, 938, 388, 718, 50308, 458, 405, 114, 171, 114, 3085, 25774, 43137, 17771, 1368, 19313, 1444, 428, 419, 12427, 792, 480, 363, 741, 7395, 8505, 3656, 523, 358, 10687, 11977, 391, 792, 712, 441, 321, 439, 363, 792, 2095, 8480, 388, 363, 11977, 938, 1082, 19313, 1444, 12344, 419, 1791, 14352, 11202, 458, 405, 114, 171, 114, 517, 17929, 453, 134, 172, 840, 43137, 1368, 865, 4463, 387, 529, 938, 19313, 1444, 12344, 419, 3322, 358, 618, 4151, 3673, 840, 878, 5462, 3442, 2263, 14334, 430, 878, 835, 17891, 561, 408, 13206, 517, 363, 29478, 10307, 897, 6278, 25727, 114, 412, 16410, 2744, 865, 31559, 458, 4471, 1368, 16004, 611, 10664, 7660, 32074, 9050, 633, 391, 15244, 633, 7484, 10249, 865, 6700, 1321, 463, 28816, 26592, 20772, 21085, 458, 13061, 1368, 865, 19865, 865, 3368, 6404, 865, 380, 114, 779, 865, 18282, 430, 363, 321, 50092, 2095, 938, 578, 8352, 490, 888, 1321, 2371, 865, 16004, 611, 10664, 3841, 1479, 11385, 114, 12026, 18869, 114, 886, 115, 486, 115, 369, 115, 15491, 2987, 115, 4453, 116, 4625, 23015, 16004, 611, 10664, 2739, 1479, 27403, 114, 15026, 180, 5744, 114, 886, 115, 1278, 26753, 114, 10222, 131, 170, 129, 2000, 106, 184, 129, 4190, 32684, 10664, 16004, 611, 385, 1159, 2739, 1479, 27403, 114, 15026, 180, 5744, 114, 886, 115, 1278, 26753, 114, 10222, 131, 184, 129, 13449, 37029, 16004, 611, 10664, 7660, 23718, 25401, 2035, 1697, 20956, 10249, 458, 13061, 1368, 865, 16004, 611, 10664, 13952, 13509, 938, 321, 50092, 2095, 2739, 1479, 2604, 114, 5690, 1234, 17280, 3109, 114, 886, 115, 174, 38021, 115, 180, 115, 32226, 2640, 114, 19312, 16004, 611, 10664, 5866, 635, 4297, 32074, 388, 4065, 18993, 16645, 3841, 1479, 11385, 114, 18141, 114, 886, 115, 369, 113, 486, 115, 6636, 19105, 42649, 16004, 611, 10664, 7660, 45350, 1444, 428, 458, 12344, 1368, 10249, 865, 7098, 32757, 114, 40586, 114, 886, 114, 3151, 633, 7744, 633, 1643, 865, 43125, 3151, 633, 939, 633, 2635, 865, 16004, 611, 10664, 7660, 31788, 12344, 10249, 865, 7098, 32757, 114, 40586, 114, 886, 114, 3151, 633, 7744, 633, 1643, 865, 43125, 3151, 633, 939, 633, 2635, 865, 16004, 611, 10664, 7660, 19313, 633, 12344, 6871, 387, 19313, 633, 12344, 388, 363, 3333, 7568, 36833, 10249, 865, 36833, 118, 114, 501, 992, 16078, 14289, 114, 886, 865, 43125, 3151, 633, 939, 633, 2635, 865, 16004, 611, 10664, 3841, 1479, 2604, 114, 41892, 114, 2499, 115, 43877, 115, 469, 16537, 115, 28558, 115, 178, 11599, 16537, 115, 15511, 1147, 115, 7367, 37043, 113, 44856, 113, 167, 5680, 1673, 3368, 2635, 938, 2422, 938, 480, 363, 6479, 1992, 10951, 865, 16004, 611, 10664, 7660, 36746, 10415, 1159, 44008, 2792, 10249, 865, 36746, 114, 2499, 865, 43125, 3151, 633, 939, 633, 2635, 865, 16004, 611, 10664, 7660, 42613, 156, 1478, 43137, 743, 114, 116, 6625, 865, 633, 594, 2343, 172, 321, 44856, 633, 370, 21461, 10249, 865, 541, 486, 773, 114, 886, 865, 43125, 3151, 633, 939, 633, 2635, 865, 4192, 736, 458, 4471, 1368, 4583, 2682, 17529, 5894, 31936, 5894, 458, 7909, 1368, 32074, 8352, 5643, 8352, 1056, 3556, 3502, 7584, 8352, 6880, 15677, 12445, 1321, 16119, 458, 4297, 1368, 12445, 8743, 30378, 9556, 458, 4297, 1368, 1321, 4065, 458, 5514, 1368, 3216, 15180, 37582, 13757, 8352, 17529, 5894, 31936, 5894, 23635, 5894, 477, 633, 13757, 42216, 8352, 19509, 8352, 7974, 3306, 1321, 7974, 5689, 6096, 5369, 16420, 21961, 39984, 6163, 1321, 8330, 1980, 4188, 1542, 5258, 13301, 35936, 23621, 17005, 4788, 2419, 500, 39324, 2095, 15737, 15518, 5229, 30633, 824, 15654, 8352, 12679, 3260, 4583, 2682, 12344, 1321, 321, 50092, 29983, 865, 4434, 4643, 8352, 458, 4434, 938, 17477, 938, 20542, 1368, 4478, 2095, 42856, 2095, 50154, 32074, 12562, 32074, 29502, 43125, 523, 7660, 3841, 1479, 369, 114, 31367, 114, 2499, 115, 187, 115, 9731, 114, 10222, 131, 7940, 129, 31838, 163, 2640, 106, 450, 20940, 129, 36189, 42351, 19039, 10249, 45587, 1159, 13952, 8352, 3907, 633, 387, 633, 4198, 4643, 20559, 9477, 1159, 5414, 17575, 11156, 936, 1992, 6218, 1540, 6786, 427, 844, 4095, 2757, 2368, 22799, 427, 844, 4095, 2757, 2368, 523, 2794, 1685, 12268, 26815, 8095, 15413, 321, 301, 169, 100, 184, 1538, 1125, 40869, 12424, 264, 15253, 321, 100, 33958, 10216, 321, 100, 321, 100, 500, 5803, 4548, 321, 100, 321, 100, 2266, 20646, 4448, 45385, 267, 183, 321, 100, 321, 100, 1321, 357, 9560, 264, 165, 321, 100, 5413, 6218, 871, 2544, 474, 1039, 13113, 420, 1206, 3368, 2278, 938, 480, 7870, 1159, 7366, 865, 8356, 419, 1796, 840, 363, 17505, 13916, 45437, 633, 8835, 133, 2440, 13890, 2263, 3325, 2947, 844, 4275, 865, 2851, 1363, 529, 2625, 938, 446, 4337, 385, 363, 17738, 387, 5866, 391, 16878, 7921, 865, 15413, 321, 207, 419, 358, 6924, 16129, 387, 363, 44978, 5794, 938, 3558, 114, 938, 358, 1830, 113, 9284, 4110, 865, 8095, 15413, 66], "start_token": 1152, "end_token": 1157, "category": 1}
|
{"input_ids": [65, 609, 419, 13878, 388, 363, 3908, 1413, 561, 792, 6068, 66, 415, 1781, 5615, 18551, 458, 2747, 1368, 633, 321, 31367, 415, 1781, 5615, 18551, 458, 2747, 1368, 16004, 385, 1159, 16509, 938, 3090, 415, 1781, 5615, 18551, 410, 25181, 8244, 2751, 12069, 36303, 11298, 517, 5357, 5505, 16156, 451, 14993, 19614, 517, 39163, 12913, 8040, 21943, 2617, 44486, 507, 992, 1065, 27333, 507, 1739, 796, 17643, 1012, 447, 49539, 24339, 10127, 5790, 6203, 10466, 15317, 1860, 517, 6067, 5357, 5505, 23458, 5209, 1068, 394, 8463, 517, 4523, 428, 29273, 6067, 5357, 5505, 23458, 5209, 1068, 394, 13504, 420, 484, 1305, 1722, 387, 13268, 438, 32782, 3008, 1907, 550, 114, 4000, 4564, 1737, 4728, 4571, 21399, 35013, 1316, 5432, 1837, 2405, 5150, 16481, 11852, 1113, 37380, 507, 27480, 906, 17003, 2365, 1799, 7950, 517, 23458, 5209, 1068, 394, 22033, 45602, 15013, 8904, 6603, 2916, 34313, 517, 6959, 5357, 5505, 23458, 5209, 1068, 394, 19275, 2807, 8040, 21943, 2617, 25416, 12734, 20152, 4138, 4408, 6270, 517, 14637, 10595, 5668, 1690, 3561, 37911, 13969, 3229, 2906, 1568, 938, 2965, 458, 2965, 633, 7744, 633, 1568, 1368, 18263, 741, 9897, 2532, 13047, 1679, 1930, 15518, 3695, 15502, 821, 123, 1611, 8416, 2708, 821, 6100, 114, 125, 1611, 415, 1781, 5615, 18551, 419, 358, 2965, 1706, 4403, 10613, 2747, 8025, 517, 363, 5357, 5505, 16156, 391, 3295, 517, 4523, 428, 29273, 938, 6067, 5357, 5505, 938, 391, 23458, 5209, 1068, 394, 938, 2013, 420, 363, 1722, 2258, 363, 30860, 5409, 3597, 387, 363, 1077, 1539, 938, 363, 1367, 633, 6402, 4403, 2161, 387, 578, 741, 865, 484, 2747, 5889, 550, 114, 4000, 4564, 1737, 456, 13268, 438, 32782, 938, 363, 1186, 14116, 609, 2731, 363, 3597, 647, 566, 2877, 452, 566, 3089, 458, 17003, 2365, 1799, 1368, 865, 4728, 4571, 21399, 938, 1837, 2405, 5150, 16481, 11852, 938, 1113, 37380, 507, 27480, 906, 938, 391, 35013, 1316, 5432, 736, 3592, 865, 415, 1781, 5615, 18551, 474, 2817, 388, 363, 1679, 1930, 420, 2906, 1568, 938, 2965, 865, 733, 569, 409, 5052, 36723, 821, 6100, 1611, 8789, 1129, 358, 3328, 4567, 387, 821, 123, 1611, 938, 391, 419, 363, 2469, 4612, 633, 409, 5052, 12316, 2748, 3283, 16704, 387, 578, 633, 741, 388, 363, 1679, 1930, 865, 2874, 9289, 15443, 441, 456, 20987, 391, 4468, 441, 456, 382, 9126, 3789, 385, 685, 4663, 633, 2013, 7429, 938, 1082, 1955, 1545, 441, 6329, 391, 517, 633, 363, 633, 3247, 865, 26815, 458, 7909, 1368, 453, 28215, 463, 5934, 614, 19275, 705, 898, 4617, 705, 114, 117, 8416, 2708, 705, 114, 118, 17785, 2983, 743, 31559, 819, 34680, 6218, 28215, 458, 4471, 1368, 21909, 523, 358, 1464, 452, 382, 19647, 3089, 938, 939, 633, 715, 633, 1569, 13268, 438, 32782, 419, 5811, 673, 480, 358, 4403, 1514, 517, 566, 2903, 938, 911, 440, 11286, 28209, 865, 14539, 566, 1542, 523, 1514, 938, 13268, 7329, 566, 2903, 569, 1465, 391, 386, 13902, 490, 10930, 708, 31086, 938, 3857, 385, 358, 3619, 19308, 452, 566, 3089, 13615, 938, 609, 2854, 10905, 387, 784, 865, 13313, 1669, 938, 438, 32782, 419, 388, 6334, 1690, 1130, 1625, 391, 10792, 28209, 865, 468, 15917, 385, 15048, 566, 3089, 938, 440, 6241, 2813, 4447, 865, 2203, 938, 440, 419, 6787, 938, 7264, 1212, 42516, 391, 7565, 566, 3552, 865, 655, 1603, 385, 888, 611, 363, 10925, 440, 662, 2152, 523, 4447, 938, 440, 5996, 611, 430, 2748, 1499, 938, 363, 792, 1796, 1499, 1465, 865, 31001, 938, 438, 32782, 419, 8787, 385, 408, 358, 2229, 33125, 865, 2394, 363, 3538, 17692, 784, 13878, 388, 363, 6666, 2810, 10195, 19273, 387, 6334, 1690, 1130, 1625, 938, 774, 26318, 784, 456, 4525, 407, 938, 363, 1186, 2698, 388, 363, 1625, 3328, 387, 10534, 865, 780, 958, 400, 571, 1661, 566, 3089, 387, 566, 2698, 388, 363, 812, 938, 391, 1082, 13268, 569, 17551, 385, 363, 13878, 8766, 387, 363, 737, 938, 13615, 12513, 35853, 452, 6150, 32793, 2457, 938, 576, 17668, 385, 1661, 13268, 494, 28209, 647, 566, 4991, 13770, 865, 484, 1809, 3430, 938, 438, 32782, 10940, 566, 40548, 452, 566, 3089, 391, 419, 18614, 517, 566, 3089, 938, 609, 996, 7566, 358, 7581, 726, 566, 1283, 865, 28209, 31149, 13268, 385, 1381, 611, 938, 576, 440, 20168, 517, 7264, 611, 452, 708, 391, 4406, 385, 5481, 566, 15908, 388, 363, 1849, 807, 21672, 865, 438, 32782, 889, 20518, 452, 363, 4198, 609, 662, 1817, 30860, 5409, 938, 391, 4292, 33275, 363, 3342, 387, 4403, 2748, 10021, 4847, 448, 1274, 17265, 458, 35013, 1316, 5432, 1368, 938, 609, 11171, 438, 32782, 391, 3112, 707, 358, 21843, 388, 19351, 938, 3857, 385, 8393, 452, 14336, 12282, 458, 25277, 10444, 14025, 1368, 391, 4000, 471, 114, 4277, 458, 14858, 448, 114, 8021, 1368, 865, 438, 32782, 569, 688, 6007, 385, 33671, 452, 28209, 938, 609, 28418, 566, 17124, 385, 4306, 452, 363, 4198, 385, 612, 7966, 19351, 21843, 865, 2994, 363, 4198, 3037, 612, 2955, 474, 363, 1367, 387, 612, 3552, 938, 2932, 10927, 5069, 363, 4198, 456, 508, 953, 1023, 1677, 385, 3778, 4507, 865, 655, 20335, 938, 438, 32782, 10763, 15480, 363, 4198, 865, 2394, 3476, 452, 448, 1274, 17265, 938, 609, 18757, 784, 385, 10669, 566, 2529, 452, 566, 3089, 938, 438, 32782, 30769, 1141, 363, 4198, 576, 7994, 585, 4144, 430, 784, 385, 7340, 566, 3089, 391, 12360, 363, 5459, 979, 585, 812, 858, 865, 438, 32782, 5961, 1464, 391, 419, 21373, 42146, 517, 566, 3089, 938, 609, 26079, 12708, 430, 784, 363, 1407, 3430, 865, 2500, 3089, 3768, 385, 524, 1817, 358, 4403, 938, 576, 13268, 419, 7418, 18089, 391, 28418, 566, 3089, 321, 439, 2998, 385, 1024, 726, 865, 655, 9094, 938, 13615, 2854, 358, 9384, 7466, 391, 7228, 566, 1569, 35902, 938, 644, 440, 651, 10820, 385, 9286, 452, 566, 3468, 865, 1182, 13268, 26079, 385, 2767, 938, 440, 7329, 604, 566, 3089, 569, 12195, 4991, 865, 13268, 391, 566, 3089, 33671, 391, 1397, 358, 2870, 6415, 979, 13615, 10665, 387, 566, 8627, 865, 2394, 566, 3089, 321, 439, 14926, 938, 438, 32782, 30769, 1141, 363, 4198, 391, 6898, 7660, 415, 1781, 5615, 18551, 10249, 865, 448, 1274, 17265, 12901, 363, 13706, 9255, 385, 1912, 8013, 938, 1491, 12282, 938, 609, 938, 7845, 3989, 517, 363, 3597, 938, 7994, 385, 1801, 441, 5324, 456, 708, 1407, 2161, 865, 484, 4198, 18279, 12282, 321, 439, 2998, 865, 438, 32782, 419, 21740, 388, 363, 5487, 719, 12282, 19683, 385, 43885, 363, 3597, 2208, 388, 10111, 865, 2203, 938, 12282, 13368, 427, 438, 32782, 916, 408, 363, 631, 385, 1803, 363, 3597, 938, 391, 4495, 441, 837, 385, 784, 938, 4686, 784, 385, 363, 21923, 385, 1803, 441, 979, 363, 1689, 5487, 865, 438, 32782, 321, 439, 10160, 2955, 419, 20379, 39012, 391, 440, 15499, 2838, 452, 28209, 938, 609, 651, 736, 688, 388, 14959, 480, 363, 10111, 865, 484, 4198, 10151, 363, 3597, 456, 612, 818, 2161, 938, 17038, 2044, 420, 4403, 391, 8762, 5344, 865, 5934, 458, 4471, 1368, 871, 1452, 419, 17604, 2263, 446, 561, 1138, 517, 11682, 441, 865, 550, 114, 4000, 4564, 1737, 456, 13268, 438, 32782, 1810, 1219, 8150, 456, 7061, 13268, 17003, 2365, 1799, 456, 13615, 438, 32782, 938, 13268, 321, 439, 3089, 1113, 37380, 507, 27480, 906, 456, 438, 13862, 808, 938, 13268, 321, 439, 18511, 4728, 4571, 21399, 456, 28209, 938, 13268, 321, 439, 11178, 410, 3710, 5336, 23693, 456, 7061, 28209, 35013, 1316, 5432, 456, 4847, 448, 1274, 17265, 938, 30860, 5409, 321, 439, 4807, 1837, 2405, 5150, 16481, 11852, 456, 9175, 114, 4564, 2145, 938, 13268, 321, 439, 4802, 25277, 10444, 14025, 456, 14336, 12282, 14858, 448, 114, 8021, 456, 4000, 471, 114, 4277, 3041, 22485, 2837, 456, 18207, 19275, 458, 4471, 1368, 871, 2766, 2577, 7219, 865, 1022, 561, 1138, 517, 4476, 385, 441, 865, 458, 2906, 2965, 1368, 484, 2747, 474, 3515, 388, 3527, 1685, 865, 17003, 2365, 1799, 5500, 363, 3451, 388, 3370, 2278, 865, 20718, 8775, 550, 114, 4000, 4564, 1737, 1939, 566, 2747, 8987, 456, 13268, 438, 32782, 865, 484, 1077, 1328, 938, 441, 474, 3515, 427, 363, 2747, 474, 23589, 430, 2751, 388, 363, 6177, 387, 2965, 865, 655, 3033, 2278, 938, 14637, 10595, 391, 5668, 1690, 3561, 37911, 4589, 420, 456, 32713, 430, 363, 2747, 430, 358, 13774, 2751, 388, 363, 1679, 1930, 865, 898, 4617, 458, 4471, 1368, 8416, 4553, 458, 4471, 1368, 1182, 387, 1838, 1612, 938, 2965, 938, 415, 1781, 5615, 18551, 569, 409, 5052, 36723, 821, 6570, 114, 120, 1611, 388, 363, 1679, 1930, 938, 391, 3441, 391, 821, 117, 114, 117, 1611, 388, 685, 16872, 938, 430, 358, 8789, 2573, 387, 821, 6100, 114, 121, 1611, 938, 1129, 358, 3328, 4567, 387, 821, 123, 1611, 865, 733, 419, 363, 2469, 633, 4612, 409, 5052, 12316, 2748, 3283, 16704, 387, 578, 633, 741, 388, 363, 1679, 1930, 938, 2258, 27781, 42302, 25955, 47163, 391, 6958, 363, 7011, 865, 484, 2747, 474, 2817, 420, 2906, 1568, 938, 2965, 938, 7949, 18629, 31524, 391, 5997, 938, 11389, 938, 391, 474, 6299, 13402, 385, 10420, 821, 118, 1478, 705, 1611, 523, 453, 112, 38951, 20651, 388, 764, 4857, 5142, 865, 2203, 938, 807, 1743, 821, 122, 114, 118, 1611, 420, 764, 818, 1211, 458, 1491, 821, 117, 114, 119, 1611, 523, 3736, 1856, 41519, 1368, 938, 5142, 7847, 648, 3321, 385, 821, 1516, 1611, 865, 733, 4545, 611, 409, 5052, 12316, 821, 1659, 114, 117, 1611, 938, 23454, 9128, 391, 12949, 2469, 480, 363, 3192, 2708, 2258, 2720, 30465, 391, 18629, 31524, 114, 8376, 4165, 387, 363, 4857, 5142, 5487, 474, 4149, 1082, 4120, 4165, 474, 726, 363, 2580, 387, 3540, 865, 733, 474, 363, 5645, 1367, 633, 1784, 4857, 430, 358, 4663, 633, 2013, 2747, 938, 1809, 484, 37681, 387, 363, 2052, 458, 821, 6100, 114, 124, 1611, 1368, 938, 6396, 387, 1894, 458, 821, 1596, 114, 122, 1611, 1368, 391, 11326, 1249, 430, 6517, 458, 821, 1929, 114, 121, 1611, 1368, 865, 655, 764, 1319, 5142, 363, 2747, 474, 2188, 385, 819, 1832, 3325, 20651, 391, 5811, 756, 779, 4165, 385, 821, 1586, 114, 124, 1611, 938, 858, 12949, 2469, 865, 733, 474, 2188, 385, 1295, 42422, 22377, 391, 5302, 5645, 388, 764, 2469, 5142, 938, 1743, 821, 1041, 114, 120, 1611, 458, 1491, 821, 119, 1611, 420, 20212, 3603, 1368, 865, 484, 2747, 582, 408, 2817, 420, 12591, 938, 12492, 633, 26943, 391, 1796, 480, 4931, 9464, 391, 3113, 3912, 9464, 938, 2896, 743, 938, 2965, 865, 17785, 2983, 458, 4471, 1368, 1651, 2524, 13363, 1453, 472, 4829, 4287, 15149, 938, 363, 2747, 6723, 382, 7647, 8056, 387, 4418, 4165, 2013, 420, 2343, 8189, 938, 391, 382, 2912, 8056, 387, 819, 1321, 939, 865, 484, 2625, 321, 439, 4789, 11630, 9844, 938, 7660, 415, 1781, 5615, 18551, 321, 439, 3376, 582, 524, 363, 850, 3029, 1972, 4403, 15680, 938, 576, 4146, 938, 764, 13390, 391, 23790, 2481, 358, 12512, 7055, 388, 4663, 633, 2013, 22142, 865, 10249, 1651, 3496, 431, 46116, 938, 363, 2747, 569, 358, 26457, 2912, 4877, 387, 2909, 604, 387, 1903, 938, 2013, 420, 868, 9289, 938, 12840, 7660, 4244, 38307, 8189, 10249, 865, 7692, 10136, 37799, 517, 31636, 26696, 3022, 363, 2747, 382, 2912, 9660, 387, 7660, 418, 1444, 10249, 420, 382, 418, 111, 385, 477, 5147, 938, 631, 387, 7481, 722, 4120, 7429, 388, 363, 2207, 387, 363, 2240, 385, 5261, 985, 358, 4877, 865, 484, 8044, 2167, 321, 439, 3801, 12251, 3022, 363, 2747, 705, 1321, 743, 5889, 391, 2731, 938, 7660, 14291, 1791, 4663, 633, 2013, 7429, 1478, 1011, 2098, 452, 13956, 10922, 494, 363, 7919, 1894, 321, 439, 1993, 5643, 2269, 1478, 4428, 385, 33051, 385, 363, 42745, 494, 390, 9351, 612, 5487, 865, 484, 513, 31754, 1141, 806, 7429, 1478, 415, 1781, 5615, 18551, 4854, 1972, 707, 1478, 490, 618, 19990, 938, 21904, 387, 4538, 391, 17937, 938, 578, 14583, 427, 490, 1565, 16474, 938, 408, 585, 19560, 388, 4403, 4663, 494, 4407, 865, 10249, 3372, 513, 11941, 33568, 387, 31628, 29552, 3022, 363, 2747, 358, 7660, 428, 1478, 10249, 2383, 1159, 7660, 1419, 321, 439, 358, 1839, 1622, 578, 387, 878, 7019, 490, 624, 18686, 29836, 1026, 2263, 1622, 585, 578, 987, 452, 6218, 385, 4259, 9394, 2263, 1622, 585, 578, 905, 689, 585, 648, 2924, 420, 382, 7234, 517, 358, 20456, 633, 4609, 550, 41242, 190, 12771, 21242, 609, 6679, 1224, 11188, 689, 363, 2431, 1758, 387, 9639, 474, 11406, 933, 891, 4425, 2745, 3784, 561, 408, 46466, 938, 576, 46466, 561, 508, 408, 1343, 865, 10249, 31559, 458, 4471, 1368, 10664, 16004, 611, 385, 1159, 39093, 938, 9943, 20702, 458, 3033, 1579, 938, 2278, 1368, 865, 7660, 16564, 633, 13504, 806, 415, 1781, 5615, 18551, 806, 451, 9585, 3306, 2851, 14637, 10595, 1323, 5668, 1690, 3561, 37911, 10249, 865, 36055, 8603, 865, 38841, 466, 7421, 6444, 865, 43125, 2906, 779, 938, 2965, 865, 10664, 16004, 611, 385, 1159, 7660, 415, 1781, 5615, 18551, 458, 2965, 1368, 10249, 865, 484, 27898, 865, 14051, 6289, 6269, 938, 11520, 865, 43125, 1838, 1261, 938, 2965, 865, 16004, 611, 10664, 6148, 938, 10026, 458, 2906, 1612, 938, 2965, 1368, 865, 7660, 1475, 851, 806, 415, 1781, 5615, 18551, 806, 1817, 363, 4195, 4403, 2378, 1784, 458, 391, 18431, 358, 3908, 1368, 5734, 10249, 865, 5017, 6389, 865, 43125, 3136, 1349, 938, 2965, 865, 16004, 611, 10664, 10084, 18006, 458, 3527, 463, 938, 1685, 1368, 865, 7660, 30860, 5409, 2378, 3597, 6326, 757, 541, 49476, 3328, 10249, 865, 3101, 11481, 865, 43125, 2906, 779, 938, 2965, 865, 10664, 16004, 611, 385, 1159, 9943, 20702, 938, 39093, 458, 3370, 743, 938, 2278, 1368, 865, 7660, 16564, 633, 13504, 13842, 806, 415, 1781, 5615, 18551, 806, 2181, 17003, 2365, 1799, 938, 1113, 37380, 507, 27480, 906, 944, 35013, 1316, 5432, 18402, 8326, 2965, 13969, 10249, 865, 36055, 8603, 865, 38841, 466, 7421, 6444, 865, 43125, 2906, 779, 938, 2965, 865, 16004, 611, 10664, 12923, 2391, 16735, 938, 32290, 458, 3033, 1579, 938, 2278, 1368, 865, 7660, 14637, 10595, 938, 5668, 1690, 4114, 29883, 16564, 633, 13504, 30748, 806, 415, 1781, 5615, 18551, 806, 10249, 865, 484, 8603, 25970, 865, 43125, 2906, 779, 938, 2965, 865, 16004, 611, 10664, 7660, 8537, 16704, 633, 7950, 27252, 480, 363, 8416, 4553, 10249, 865, 8416, 4553, 4371, 7740, 865, 43125, 3136, 1261, 938, 2965, 865, 16004, 611, 10664, 477, 5920, 938, 11854, 458, 2906, 1612, 938, 2965, 1368, 865, 7660, 2662, 806, 18629, 31524, 806, 1456, 363, 15976, 385, 9562, 29162, 806, 2720, 30465, 806, 3675, 8416, 4553, 2549, 455, 5734, 10249, 865, 484, 155, 2517, 865, 43125, 2906, 779, 938, 2965, 865, 10664, 16004, 611, 385, 1159, 461, 107, 133, 1304, 28193, 938, 10054, 458, 2906, 1568, 938, 2965, 1368, 865, 7660, 806, 2720, 30465, 806, 7796, 1518, 1215, 821, 34817, 438, 111, 655, 42987, 2263, 806, 415, 1781, 5615, 18551, 806, 4299, 18267, 1478, 8416, 4553, 10234, 10249, 865, 36055, 8603, 865, 38841, 466, 7421, 6444, 865, 43125, 2906, 1697, 938, 2965, 865, 16004, 611, 10664, 461, 107, 133, 1304, 28193, 938, 10054, 458, 2906, 1349, 938, 2965, 1368, 865, 7660, 806, 2720, 30465, 806, 3974, 25487, 448, 114, 147, 114, 20316, 3675, 806, 18629, 31524, 806, 2263, 1475, 806, 415, 1781, 5615, 18551, 806, 7387, 418, 821, 1659, 438, 3435, 5841, 10249, 865, 36055, 8603, 865, 38841, 466, 7421, 6444, 865, 43125, 2906, 1349, 938, 2965, 865, 16004, 611, 10664, 7660, 8416, 4553, 1159, 806, 415, 1781, 5615, 18551, 806, 5517, 1184, 16564, 633, 13504, 5316, 361, 10249, 865, 484, 8603, 25970, 865, 2906, 1261, 938, 2965, 865, 43125, 2906, 1261, 938, 2965, 865, 16004, 611, 10664, 461, 107, 133, 1304, 28193, 938, 10054, 458, 2906, 1780, 938, 2965, 1368, 865, 7660, 8415, 806, 8312, 29643, 1159, 572, 14720, 806, 12344, 3513, 1730, 484, 8161, 448, 114, 147, 114, 5734, 2263, 806, 2720, 30465, 806, 21495, 10024, 13367, 1478, 3603, 3048, 46616, 10249, 865, 36055, 8603, 865, 43125, 2906, 1780, 938, 2965, 865, 16004, 611, 10664, 461, 107, 133, 1304, 28193, 938, 10054, 458, 3136, 453, 938, 2965, 1368, 865, 7660, 1475, 14570, 14367, 114, 12425, 806, 23533, 7954, 1982, 806, 1651, 484, 41252, 7811, 1323, 12669, 37270, 2181, 821, 4411, 438, 111, 705, 633, 3697, 1478, 3603, 3048, 46616, 10249, 865, 36055, 8603, 865, 43125, 3136, 705, 938, 2965, 865, 16004, 611, 10664, 7660, 415, 1781, 5615, 18551, 458, 2965, 1368, 10249, 865, 472, 4829, 4287, 15149, 865, 477, 493, 14309, 865, 43125, 2906, 2909, 938, 2965, 865, 16004, 611, 10664, 7660, 415, 1781, 5615, 18551, 20972, 10249, 865, 3496, 431, 46116, 865, 11234, 21466, 865, 43125, 2906, 2635, 938, 2965, 865, 16004, 611, 10664, 12251, 938, 3801, 458, 2906, 1416, 938, 2965, 1368, 865, 7660, 16564, 633, 2013, 10613, 806, 415, 1781, 5615, 18551, 806, 958, 400, 571, 756, 33051, 385, 363, 42745, 10249, 865, 484, 8044, 2167, 865, 43125, 2906, 2635, 938, 2965, 865, 16004, 611, 10664, 513, 11941, 33568, 938, 3372, 458, 2906, 2411, 938, 2965, 1368, 865, 7660, 806, 415, 1781, 5615, 18551, 806, 6703, 1159, 418, 4403, 4732, 8537, 16704, 25257, 4263, 16564, 633, 13504, 30299, 49561, 385, 38341, 1102, 10541, 7692, 10136, 10249, 865, 31628, 29552, 865, 43125, 2906, 2635, 938, 2965, 865, 34680, 6218, 458, 4471, 1368, 16035, 3153, 415, 1781, 5615, 18551, 420, 9060, 43933, 415, 1781, 5615, 18551, 480, 363, 410, 24288, 15976, 24148, 415, 1781, 5615, 18551, 480, 1540, 25198, 415, 1781, 5615, 18551, 480, 8416, 4553, 4371, 7740, 415, 1781, 5615, 18551, 480, 7544, 3792, 114, 8603, 43125, 523, 7660, 3841, 1479, 369, 114, 31367, 114, 2499, 115, 187, 115, 9731, 114, 10222, 131, 7940, 129, 141, 163, 6191, 163, 10150, 163, 25254, 41153, 26341, 109, 106, 450, 20940, 129, 124, 43791, 39219, 2724, 10249, 45587, 1159, 2965, 7429, 3695, 633, 3404, 7429, 1706, 7429, 1706, 10613, 7429, 3151, 183, 10613, 7429, 30748, 7429, 2013, 420, 4137, 3096, 30299, 2013, 420, 4137, 3096, 5668, 1690, 3561, 37911, 7429, 30299, 2924, 388, 10534, 20559, 9477, 1159, 655, 20852, 8442, 523, 2906, 2965, 22799, 385, 408, 10003, 523, 2906, 2965, 1540, 6786, 385, 408, 10003, 22799, 1363, 1503, 3376, 10660, 22799, 7369, 6297, 14668, 6400, 523, 1838, 2965, 1540, 6786, 7369, 6297, 14668, 6400, 12268, 26815, 8095, 15413, 321, 100, 13182, 15563, 16357, 321, 100, 321, 100, 5413, 6218, 871, 2544, 474, 1039, 13113, 420, 1643, 1838, 2965, 938, 480, 1568, 1159, 3672, 865, 8356, 419, 1796, 840, 363, 17505, 13916, 45437, 633, 8835, 133, 2440, 13890, 2263, 3325, 2947, 844, 4275, 865, 2851, 1363, 529, 2625, 938, 446, 4337, 385, 363, 17738, 387, 5866, 391, 16878, 7921, 865, 15413, 321, 207, 419, 358, 6924, 16129, 387, 363, 44978, 5794, 938, 3558, 114, 938, 358, 1830, 113, 9284, 4110, 865, 8095, 15413, 66], "start_token": 266, "end_token": 274, "category": 1}
|
{"input_ids": [65, 719, 851, 3871, 2371, 1723, 705, 1383, 604, 66, 17100, 12344, 458, 1723, 705, 1368, 633, 321, 31367, 17100, 12344, 458, 1723, 705, 1368, 16004, 385, 1159, 16509, 938, 3090, 17100, 12344, 458, 1723, 705, 1368, 12591, 3103, 13047, 387, 8260, 1679, 1930, 1501, 114, 387, 8741, 2088, 13969, 13846, 3228, 5527, 13846, 2751, 2794, 453, 938, 3749, 458, 3749, 633, 7870, 633, 5635, 1368, 1478, 1838, 1416, 938, 3818, 458, 3818, 633, 8971, 633, 1416, 1368, 7470, 16300, 1536, 321, 100, 21902, 7470, 614, 7507, 321, 100, 7470, 743, 7444, 387, 17100, 12344, 8741, 484, 5645, 1723, 387, 17100, 12344, 938, 382, 1706, 11490, 10613, 5682, 2269, 32501, 31802, 388, 363, 1679, 1930, 420, 2794, 453, 938, 3749, 865, 733, 10975, 387, 2088, 8741, 458, 2635, 5682, 8741, 391, 463, 3993, 385, 12591, 8741, 1368, 938, 1568, 387, 644, 18631, 523, 2794, 385, 3527, 3749, 865, 2394, 358, 37110, 938, 441, 28392, 420, 3136, 1697, 938, 3818, 391, 8492, 420, 1838, 1416, 938, 3818, 452, 358, 835, 4572, 19624, 865, 484, 5645, 1723, 474, 3515, 456, 363, 2558, 1723, 387, 17100, 12344, 938, 2259, 363, 2269, 4605, 388, 358, 3715, 2269, 5895, 456, 17100, 12344, 1159, 30789, 938, 644, 44220, 420, 3136, 705, 938, 2278, 865, 26815, 458, 7909, 1368, 453, 5934, 453, 114, 117, 8875, 3536, 453, 114, 118, 3412, 15025, 3536, 463, 4652, 8153, 614, 19275, 705, 6096, 2157, 2751, 743, 31559, 819, 34680, 6218, 5934, 458, 4471, 1368, 8875, 3536, 458, 4471, 1368, 36502, 9431, 3947, 456, 12507, 5582, 8617, 29967, 9369, 8021, 456, 4000, 36280, 3346, 4000, 472, 32779, 735, 456, 30088, 6194, 16007, 2195, 12290, 418, 2712, 1702, 500, 12557, 1174, 456, 31164, 1879, 7614, 19237, 6585, 456, 8215, 7560, 725, 5300, 610, 811, 2949, 456, 36595, 7660, 410, 633, 20228, 10249, 20228, 4154, 5281, 40255, 456, 3801, 471, 10135, 1855, 6136, 424, 16465, 270, 165, 456, 41528, 645, 6127, 2289, 550, 23231, 10451, 541, 107, 48223, 456, 35978, 6708, 10906, 10591, 13430, 2300, 13609, 456, 24900, 11919, 6199, 13841, 4078, 477, 30931, 1109, 456, 10110, 8983, 606, 3412, 15025, 3536, 458, 4471, 1368, 10693, 1988, 397, 456, 3712, 11333, 13786, 46370, 28209, 7699, 1053, 456, 30088, 6194, 16007, 7482, 1890, 468, 22251, 49624, 468, 1799, 2825, 456, 15479, 17005, 562, 428, 702, 6585, 456, 39118, 6651, 6492, 1660, 31376, 29439, 9721, 456, 33774, 8150, 36280, 3346, 11497, 2778, 456, 21943, 1782, 3801, 16003, 3388, 11409, 507, 13582, 456, 29862, 17652, 4000, 17958, 4242, 456, 20754, 2736, 37565, 412, 166, 1477, 456, 21094, 40866, 6676, 34172, 456, 18265, 468, 7359, 16786, 12983, 10127, 456, 5450, 16007, 14038, 33678, 16433, 6643, 4287, 456, 22660, 410, 2922, 25412, 5346, 23378, 19736, 456, 6959, 448, 5132, 38987, 24354, 2083, 20676, 456, 42706, 10906, 11621, 2083, 152, 716, 781, 456, 15132, 30145, 37313, 4134, 12728, 456, 8543, 1547, 564, 33543, 35289, 11184, 456, 16626, 541, 1019, 5288, 6337, 28498, 456, 11189, 17569, 4000, 541, 107, 26639, 456, 30088, 5991, 34959, 36543, 2300, 14586, 637, 8654, 456, 24598, 8983, 606, 3463, 418, 12482, 5815, 456, 3463, 25144, 2325, 3041, 451, 13586, 2265, 2980, 456, 10026, 670, 49995, 49308, 3995, 1529, 456, 4847, 415, 7886, 2907, 26780, 456, 1684, 114, 18754, 3938, 19971, 9083, 7903, 456, 5450, 16007, 3041, 27613, 4078, 9448, 948, 456, 5450, 16007, 5281, 22299, 33918, 8228, 456, 5450, 16007, 8228, 12307, 4732, 6428, 5749, 5758, 456, 14634, 20505, 7660, 428, 633, 5841, 10249, 14122, 1858, 412, 4167, 3942, 456, 49637, 37549, 13070, 438, 12528, 1203, 456, 1980, 17795, 5451, 13707, 1540, 906, 456, 507, 114, 142, 114, 5582, 8617, 6603, 1867, 790, 456, 18729, 10766, 16007, 6320, 29458, 21703, 32988, 15060, 456, 7617, 2789, 4592, 8923, 4652, 8153, 458, 4471, 1368, 8875, 2809, 1159, 7444, 387, 17100, 12344, 8741, 1501, 865, 4146, 1501, 114, 388, 1723, 11952, 36303, 11298, 517, 22604, 517, 13846, 1734, 3229, 451, 14993, 865, 2539, 572, 114, 151, 114, 10310, 458, 5343, 1368, 7719, 7660, 32353, 8567, 10249, 8040, 468, 31186, 4806, 6645, 177, 28145, 2794, 453, 938, 3749, 458, 3749, 633, 7870, 633, 5635, 1368, 705, 10307, 142, 587, 819, 114, 4411, 36280, 3346, 8440, 471, 10135, 1855, 938, 10906, 391, 8983, 606, 385, 358, 2252, 938, 911, 471, 10135, 1855, 4179, 2488, 358, 2277, 2758, 979, 23446, 441, 17449, 865, 36280, 3346, 14544, 385, 1595, 708, 430, 11919, 6199, 13841, 321, 439, 5224, 938, 576, 774, 10170, 427, 363, 6947, 419, 6877, 865, 36280, 3346, 3949, 12507, 938, 609, 419, 2978, 358, 12410, 1305, 452, 507, 114, 142, 114, 391, 41528, 645, 388, 23620, 865, 484, 3712, 34162, 10906, 430, 6180, 358, 4967, 2528, 387, 363, 2757, 2758, 391, 6367, 39118, 6651, 6492, 1660, 938, 566, 390, 24522, 906, 385, 1112, 1438, 387, 708, 865, 36280, 3346, 11286, 471, 10135, 1855, 938, 609, 1661, 363, 2067, 647, 32353, 8567, 938, 363, 6947, 321, 439, 2758, 427, 5010, 363, 5935, 321, 439, 2143, 1593, 2263, 576, 6651, 6492, 1660, 14544, 938, 12948, 471, 10135, 1855, 391, 46874, 363, 2758, 865, 12507, 12948, 358, 5935, 28710, 391, 419, 5270, 865, 8983, 606, 7329, 604, 427, 6651, 6492, 1660, 569, 3024, 363, 2067, 321, 439, 3468, 865, 1879, 7614, 391, 7560, 725, 490, 4703, 385, 524, 13638, 412, 4551, 938, 644, 474, 23100, 865, 20228, 4154, 569, 736, 13638, 391, 569, 3453, 385, 1542, 385, 363, 572, 114, 151, 114, 385, 9262, 471, 10135, 1855, 321, 439, 1593, 865, 780, 419, 10059, 452, 566, 1646, 388, 363, 1706, 45389, 865, 36280, 3346, 15499, 2838, 452, 11919, 6199, 13841, 391, 585, 2554, 30088, 5898, 3860, 12290, 321, 439, 2998, 385, 8652, 32353, 8567, 391, 7534, 363, 5935, 388, 5264, 430, 17090, 938, 674, 3824, 611, 452, 5582, 8617, 938, 8983, 606, 938, 1879, 7614, 391, 7560, 725, 865, 7964, 7660, 25043, 1323, 2140, 20313, 10249, 17256, 16232, 30819, 10163, 12870, 2794, 453, 938, 3749, 458, 3749, 633, 7870, 633, 5635, 1368, 705, 10307, 142, 3100, 819, 114, 4411, 484, 1175, 14544, 388, 5502, 5753, 2263, 391, 363, 1967, 490, 1914, 19948, 15573, 4511, 391, 1927, 20153, 29862, 17652, 938, 358, 3745, 5988, 865, 5582, 8617, 10598, 15928, 385, 8983, 606, 807, 363, 4466, 419, 13114, 865, 8983, 606, 15415, 385, 1165, 363, 2758, 13930, 933, 566, 4740, 938, 4251, 8983, 606, 2598, 480, 363, 2252, 865, 17652, 2686, 427, 585, 792, 862, 385, 4967, 363, 2758, 1363, 566, 2142, 3436, 938, 644, 561, 8812, 698, 8015, 6244, 3436, 321, 439, 1467, 388, 20488, 865, 484, 1175, 23761, 427, 8319, 363, 24242, 419, 5441, 391, 2528, 1335, 17652, 321, 439, 3436, 388, 363, 18908, 321, 439, 6232, 391, 524, 363, 2758, 19085, 2263, 576, 774, 5768, 363, 3436, 480, 363, 24242, 391, 363, 1175, 15415, 385, 3903, 391, 8652, 363, 3436, 865, 11315, 938, 6651, 6492, 1660, 419, 1820, 10906, 22586, 430, 1422, 391, 7329, 604, 427, 363, 9498, 391, 363, 1955, 490, 400, 571, 34047, 2263, 440, 7329, 11189, 17569, 391, 5041, 7720, 971, 784, 865, 20228, 4154, 12948, 566, 1646, 391, 25466, 784, 388, 1603, 385, 7967, 865, 780, 419, 1914, 358, 6695, 517, 376, 25014, 385, 3087, 9601, 938, 4851, 388, 363, 1593, 938, 911, 440, 46874, 1694, 2688, 523, 358, 3192, 865, 484, 1175, 7329, 604, 427, 585, 792, 524, 631, 387, 363, 2338, 4217, 427, 1397, 363, 1945, 32353, 8567, 865, 36280, 3346, 19849, 566, 9787, 16933, 865, 3227, 7660, 18837, 5689, 10249, 21675, 428, 20443, 27187, 8148, 10945, 5900, 2794, 908, 938, 3749, 458, 3749, 633, 7870, 633, 8588, 1368, 705, 10307, 142, 3171, 819, 114, 2724, 484, 1175, 44947, 685, 1467, 12012, 523, 363, 24242, 388, 1603, 385, 1165, 363, 685, 2758, 10577, 865, 8983, 606, 7994, 5450, 5898, 16433, 385, 1138, 784, 1165, 566, 3468, 321, 439, 11969, 865, 12290, 321, 439, 21378, 938, 5898, 34959, 36543, 938, 3164, 17487, 9063, 461, 12255, 385, 1603, 363, 15715, 387, 363, 4466, 865, 484, 1175, 46874, 7338, 938, 644, 490, 17604, 391, 585, 42212, 363, 4483, 2716, 391, 7431, 363, 1435, 865, 1879, 7614, 391, 7560, 725, 490, 5270, 517, 30088, 6655, 938, 17652, 14869, 2258, 391, 363, 1955, 6755, 865, 1220, 6788, 385, 1165, 363, 3350, 4168, 391, 36280, 3346, 15841, 1082, 363, 1955, 490, 5270, 1266, 865, 36280, 3346, 5961, 452, 358, 2747, 440, 6365, 4579, 363, 6799, 387, 363, 2338, 2758, 10577, 938, 631, 953, 363, 3712, 2342, 865, 12290, 13368, 385, 1410, 363, 1175, 2656, 363, 4466, 865, 11315, 938, 6651, 6492, 1660, 3112, 746, 1422, 523, 17569, 391, 12948, 784, 865, 20228, 4154, 6241, 1820, 1358, 388, 471, 10135, 1855, 321, 439, 2257, 391, 3949, 358, 1765, 1545, 7660, 503, 6259, 10249, 391, 419, 9268, 385, 568, 391, 3429, 566, 2299, 865, 8983, 606, 11684, 358, 2494, 523, 16433, 7369, 363, 1845, 26292, 865, 484, 1175, 27573, 427, 566, 3468, 419, 3024, 391, 5582, 8617, 3544, 19432, 3016, 452, 784, 865, 8555, 7660, 13886, 1323, 17755, 10249, 4000, 2552, 10658, 610, 38722, 4122, 473, 2794, 1416, 938, 3749, 458, 3749, 633, 7870, 633, 1416, 1368, 705, 10307, 142, 3124, 743, 114, 3821, 484, 1175, 5905, 363, 9764, 863, 478, 419, 358, 2758, 13930, 938, 576, 23761, 427, 566, 3757, 938, 15479, 17005, 562, 609, 419, 736, 363, 3712, 321, 439, 5058, 938, 419, 865, 1220, 1165, 708, 2509, 385, 752, 2070, 385, 979, 43954, 20228, 4154, 391, 21531, 784, 2263, 576, 585, 1376, 400, 571, 1165, 363, 1593, 391, 440, 32796, 865, 484, 1175, 7329, 604, 427, 17005, 562, 582, 5363, 358, 1745, 14496, 865, 36280, 3346, 938, 5582, 8617, 391, 8983, 606, 5907, 22652, 391, 7776, 4967, 363, 2758, 2263, 576, 631, 387, 708, 1868, 33528, 21671, 391, 5780, 5582, 8617, 391, 363, 6947, 12948, 784, 517, 7560, 725, 321, 439, 1138, 865, 11315, 938, 11919, 6199, 13841, 419, 8082, 387, 17569, 321, 439, 2019, 391, 3112, 19196, 865, 1476, 3026, 385, 358, 2341, 938, 911, 358, 683, 28153, 391, 3645, 708, 3985, 2758, 938, 644, 419, 12427, 517, 363, 5935, 865, 20228, 4154, 5041, 1863, 480, 503, 6259, 938, 3350, 20754, 2736, 938, 363, 6224, 938, 410, 37619, 22053, 4277, 938, 363, 7806, 391, 448, 5132, 38987, 938, 1295, 21221, 865, 484, 2067, 19849, 358, 1539, 938, 1496, 379, 938, 388, 363, 1593, 865, 655, 1069, 2072, 2355, 938, 1496, 379, 419, 3024, 517, 566, 6579, 430, 566, 5388, 385, 752, 32353, 8567, 865, 8983, 606, 6581, 1330, 1013, 17652, 385, 1138, 784, 1165, 566, 3468, 321, 439, 11969, 865, 6651, 6492, 1660, 14544, 480, 363, 2341, 391, 5041, 20124, 11919, 6199, 13841, 865, 8291, 743, 7660, 20079, 1323, 9607, 10249, 18779, 503, 716, 30393, 20295, 29111, 2794, 2635, 938, 3749, 458, 3749, 633, 7870, 633, 2635, 1368, 705, 10307, 142, 2814, 743, 114, 5806, 8983, 606, 321, 439, 3757, 938, 24598, 938, 21180, 6651, 6492, 1660, 391, 18757, 784, 385, 1595, 363, 6947, 865, 11919, 6199, 13841, 15415, 385, 4526, 363, 6947, 391, 363, 1175, 23761, 427, 440, 3483, 385, 1595, 707, 865, 1220, 1546, 430, 363, 1407, 2758, 1082, 8983, 606, 5041, 10341, 6651, 6492, 1660, 865, 12290, 14271, 363, 2758, 13930, 321, 439, 2220, 391, 10244, 385, 4967, 363, 2758, 938, 576, 3708, 363, 23615, 387, 363, 3439, 385, 363, 1175, 391, 3112, 707, 388, 363, 2716, 865, 5582, 8617, 19849, 36280, 3346, 321, 439, 9787, 16933, 865, 1220, 6788, 385, 4967, 363, 2758, 1082, 541, 1019, 938, 363, 2758, 13930, 938, 419, 3350, 363, 3712, 938, 609, 2686, 427, 32353, 8567, 419, 363, 1839, 363, 5935, 569, 1277, 865, 11315, 938, 8983, 606, 7329, 363, 44505, 6651, 6492, 1660, 474, 10690, 388, 391, 19849, 363, 2554, 516, 4686, 6651, 6492, 1660, 938, 391, 2854, 363, 1372, 517, 2801, 865, 10906, 15415, 385, 1580, 5324, 865, 1879, 7614, 391, 7560, 725, 3090, 363, 6817, 6933, 430, 20228, 4154, 391, 1661, 4277, 427, 713, 419, 358, 11697, 430, 5843, 707, 1165, 20228, 4154, 2263, 576, 774, 13368, 385, 752, 618, 523, 20228, 4154, 2528, 865, 20228, 4154, 419, 8773, 517, 18265, 468, 7359, 938, 1496, 379, 321, 439, 6579, 938, 609, 20302, 385, 1595, 784, 712, 440, 958, 400, 571, 752, 32353, 8567, 2683, 865, 484, 1175, 4749, 26974, 427, 363, 3712, 419, 363, 1283, 387, 363, 5935, 865, 8194, 819, 7660, 26689, 3907, 10249, 17958, 26343, 12713, 22362, 670, 1132, 22382, 2794, 2909, 938, 3749, 458, 3749, 633, 7870, 633, 2909, 1368, 705, 10307, 142, 3413, 743, 114, 2179, 484, 1175, 15415, 385, 4967, 363, 1407, 2758, 452, 382, 16063, 1511, 2263, 576, 8983, 606, 419, 5270, 517, 363, 1745, 1082, 20323, 17652, 321, 439, 3436, 2263, 391, 12290, 792, 15415, 385, 752, 363, 3436, 865, 484, 1175, 419, 9187, 1872, 385, 3714, 8983, 606, 494, 1546, 385, 363, 1407, 2758, 865, 1220, 3544, 3954, 385, 10093, 784, 388, 363, 2285, 938, 911, 6651, 6492, 1660, 569, 736, 5385, 385, 1595, 784, 865, 8983, 606, 419, 7549, 7776, 865, 780, 3949, 6651, 6492, 1660, 391, 10598, 385, 1165, 784, 979, 9745, 363, 1372, 1598, 938, 644, 419, 12012, 517, 17652, 865, 11315, 938, 35978, 6708, 15499, 2838, 452, 708, 6722, 938, 42706, 938, 391, 5058, 938, 17709, 938, 609, 5905, 42706, 419, 708, 2903, 865, 35978, 6708, 46874, 358, 2586, 391, 718, 1738, 523, 358, 7080, 774, 651, 1914, 42706, 4372, 391, 15841, 452, 3453, 387, 1863, 430, 5324, 865, 484, 3712, 569, 1144, 604, 12290, 321, 439, 3746, 420, 784, 391, 6367, 358, 30088, 4375, 5898, 385, 3090, 566, 3745, 391, 6651, 6492, 1660, 385, 9929, 784, 865, 448, 5132, 38987, 7329, 5394, 4570, 388, 20228, 4154, 321, 439, 49285, 3552, 391, 363, 6947, 37627, 363, 2257, 391, 6471, 385, 6755, 979, 953, 7485, 517, 35978, 6708, 865, 5699, 868, 7660, 10680, 363, 7013, 6479, 10249, 45455, 418, 114, 4474, 4403, 8599, 2640, 3368, 819, 938, 3749, 458, 3749, 633, 939, 633, 9231, 1368, 705, 10307, 142, 3099, 743, 114, 2819, 20228, 4154, 4495, 10906, 385, 771, 2079, 865, 8983, 606, 34239, 12290, 385, 1112, 363, 2008, 385, 363, 3712, 2528, 387, 11917, 2263, 391, 12290, 1939, 363, 6947, 14342, 363, 4742, 420, 784, 865, 484, 1175, 23761, 427, 1547, 564, 33543, 938, 363, 1407, 2758, 13930, 938, 419, 3159, 388, 10224, 9722, 938, 1082, 585, 490, 8082, 517, 4277, 387, 20228, 4154, 321, 439, 33136, 865, 36280, 3346, 938, 8983, 606, 391, 7560, 725, 2753, 385, 1165, 20228, 4154, 1082, 363, 1955, 3168, 385, 9722, 865, 5582, 8617, 5053, 11919, 6199, 13841, 387, 36280, 3346, 321, 439, 4107, 938, 644, 23061, 385, 745, 3024, 612, 2903, 480, 427, 2580, 865, 484, 2758, 419, 7776, 19085, 2263, 576, 17652, 321, 439, 30836, 12408, 2583, 388, 6179, 363, 3436, 865, 11315, 938, 36280, 3346, 321, 439, 1175, 23761, 427, 363, 970, 474, 358, 475, 2005, 517, 20228, 4154, 2263, 792, 8983, 606, 15415, 385, 6755, 865, 20228, 4154, 3487, 36280, 3346, 385, 475, 30513, 15241, 363, 30982, 7205, 388, 363, 9574, 387, 363, 1593, 865, 8983, 606, 7329, 363, 2257, 517, 363, 15573, 4511, 2263, 576, 585, 490, 1642, 3851, 456, 10906, 13590, 363, 4511, 388, 741, 865, 10906, 12948, 448, 5132, 38987, 456, 358, 13142, 865, 36280, 3346, 15415, 385, 1945, 363, 30982, 391, 6084, 20228, 4154, 385, 382, 11548, 17636, 517, 20228, 4154, 321, 439, 2708, 388, 503, 6259, 865, 8983, 606, 14544, 391, 20228, 4154, 419, 9071, 388, 358, 2220, 865, 36280, 3346, 3112, 358, 970, 523, 10906, 938, 609, 24620, 5324, 363, 2288, 741, 865, 6236, 908, 7660, 484, 7987, 10249, 17256, 16232, 11621, 29862, 3368, 1261, 938, 3749, 458, 3749, 633, 939, 633, 1261, 1368, 705, 10307, 142, 3020, 743, 114, 2332, 10906, 1939, 358, 39955, 452, 36280, 3346, 938, 3602, 784, 363, 1435, 387, 363, 9574, 391, 20228, 4154, 419, 2817, 865, 1220, 5510, 385, 771, 2079, 385, 2323, 967, 363, 5935, 865, 5582, 8617, 5745, 382, 1469, 420, 13786, 46370, 806, 1198, 391, 2364, 363, 1039, 2758, 938, 644, 419, 6426, 865, 17652, 419, 3451, 604, 387, 363, 1511, 881, 387, 566, 30836, 12408, 427, 8825, 388, 6179, 363, 3436, 865, 780, 4495, 363, 1175, 321, 439, 33136, 385, 6651, 6492, 1660, 388, 5264, 430, 1738, 391, 17122, 566, 19749, 517, 3602, 363, 1175, 321, 439, 1511, 1598, 938, 7287, 388, 1879, 7614, 953, 19576, 2924, 938, 3126, 14230, 11919, 6199, 13841, 12545, 385, 865, 17652, 3026, 385, 1927, 6651, 6492, 1660, 938, 609, 20712, 391, 7720, 1043, 784, 385, 1661, 363, 1175, 321, 439, 4168, 865, 11237, 4041, 17652, 517, 358, 30114, 36280, 3346, 1335, 388, 566, 13325, 938, 363, 1175, 14544, 391, 551, 6178, 1013, 6651, 6492, 1660, 938, 2607, 5576, 523, 4000, 5768, 17652, 385, 33606, 385, 566, 14230, 865, 11315, 938, 18265, 8505, 385, 1595, 20228, 4154, 456, 440, 8173, 2263, 576, 10906, 3164, 17487, 784, 385, 1678, 707, 618, 741, 865, 20228, 4154, 6581, 1330, 1013, 4277, 385, 9262, 363, 1955, 865, 11919, 6199, 13841, 19432, 3016, 452, 10906, 881, 387, 363, 1175, 865, 35124, 25749, 427, 363, 2331, 474, 430, 566, 2758, 508, 566, 1305, 938, 13786, 46370, 13368, 385, 4452, 32353, 8567, 865, 8031, 961, 7660, 3979, 1209, 26320, 39692, 10249, 18134, 448, 5475, 1174, 8148, 10945, 5900, 3490, 614, 938, 3749, 458, 3749, 633, 1468, 633, 7744, 1368, 705, 10307, 142, 3032, 743, 114, 2055, 484, 1175, 7720, 1043, 6651, 6492, 1660, 385, 888, 784, 1661, 13786, 46370, 427, 585, 490, 2737, 1082, 12275, 8983, 606, 523, 2364, 566, 15928, 1667, 363, 28738, 419, 1861, 865, 11919, 6199, 13841, 419, 7248, 385, 11609, 6651, 6492, 1660, 2263, 576, 774, 10244, 865, 733, 419, 4703, 385, 408, 358, 1511, 385, 1801, 566, 3910, 1363, 1281, 2557, 391, 12290, 456, 43717, 7790, 984, 2557, 938, 1743, 358, 6928, 12417, 363, 4466, 321, 439, 29441, 938, 644, 12290, 5442, 385, 13786, 46370, 420, 363, 3173, 2263, 391, 440, 3112, 22699, 391, 370, 1293, 1525, 363, 7634, 5298, 440, 6128, 865, 8983, 606, 7720, 1043, 6651, 6492, 1660, 1667, 440, 14487, 385, 5012, 17130, 385, 24598, 938, 807, 644, 440, 419, 3024, 865, 11315, 938, 2736, 5041, 10341, 448, 5132, 38987, 321, 439, 22476, 2263, 576, 20228, 4154, 39208, 363, 3175, 517, 29450, 363, 4507, 938, 4579, 363, 5394, 4570, 388, 448, 5132, 38987, 321, 439, 3552, 938, 1743, 2736, 385, 2070, 363, 1440, 388, 1603, 385, 3049, 363, 10832, 865, 10906, 5830, 19432, 3016, 452, 13786, 46370, 938, 4703, 385, 524, 688, 3051, 452, 784, 979, 865, 1476, 7329, 604, 647, 363, 4452, 865, 484, 1175, 7329, 358, 1761, 12757, 12114, 612, 936, 391, 15415, 385, 752, 2074, 441, 938, 576, 480, 363, 1676, 387, 7560, 725, 321, 439, 1305, 865, 8376, 939, 7660, 484, 9984, 10249, 30003, 468, 114, 7804, 610, 38722, 4122, 473, 3490, 939, 938, 3749, 458, 3749, 633, 1468, 633, 939, 1368, 705, 10307, 142, 1041, 743, 114, 2649, 484, 1175, 3487, 12290, 385, 8652, 7560, 725, 321, 439, 1868, 391, 3859, 441, 385, 566, 2903, 865, 1879, 7614, 10170, 427, 440, 662, 524, 3825, 388, 363, 412, 4551, 16453, 938, 854, 964, 517, 20228, 4154, 938, 712, 7560, 725, 651, 400, 571, 7549, 363, 2067, 865, 10906, 30476, 363, 1175, 387, 13786, 46370, 806, 1511, 865, 1220, 6638, 427, 585, 1376, 400, 571, 15873, 363, 30982, 1332, 363, 8278, 865, 1220, 1165, 382, 7169, 321, 439, 1539, 388, 363, 9574, 2263, 391, 8983, 606, 3026, 385, 363, 7169, 321, 439, 2257, 938, 911, 13786, 46370, 569, 2009, 566, 999, 1551, 385, 8652, 363, 7169, 430, 566, 1511, 865, 484, 1175, 7329, 18547, 388, 358, 2220, 585, 3252, 420, 612, 936, 865, 1879, 7614, 7685, 566, 2467, 420, 358, 6265, 938, 644, 582, 20514, 479, 807, 363, 2467, 419, 6055, 865, 10906, 8505, 385, 926, 2005, 441, 865, 8983, 606, 46874, 363, 8278, 391, 15415, 385, 926, 2005, 363, 6265, 391, 3714, 1879, 7614, 865, 20228, 4154, 23761, 427, 4277, 419, 7071, 618, 722, 3039, 865, 780, 3112, 708, 970, 7982, 391, 7329, 604, 427, 774, 419, 388, 2901, 452, 12290, 865, 11315, 938, 36280, 3346, 419, 14742, 452, 48742, 25610, 488, 13923, 6187, 391, 11919, 6199, 13841, 2686, 427, 440, 582, 4757, 712, 440, 958, 400, 571, 524, 358, 8286, 2683, 865, 8358, 1468, 7660, 37456, 24629, 10249, 8040, 468, 31186, 20295, 29111, 3490, 1697, 938, 3749, 458, 3749, 633, 1468, 633, 1697, 1368, 705, 10307, 142, 1258, 743, 114, 4410, 36280, 3346, 1587, 790, 363, 1511, 430, 363, 1175, 938, 456, 440, 582, 508, 4755, 707, 881, 387, 566, 8286, 865, 10906, 5341, 6332, 358, 2050, 402, 452, 13786, 46370, 938, 388, 644, 774, 8505, 385, 8812, 566, 2758, 2263, 576, 440, 1642, 4307, 391, 8505, 385, 1595, 708, 979, 774, 17704, 784, 387, 612, 1301, 2263, 391, 440, 700, 3666, 708, 391, 5768, 865, 36280, 3346, 13368, 385, 4755, 363, 1175, 391, 5562, 363, 4466, 979, 8286, 2263, 391, 11919, 6199, 13841, 3026, 385, 567, 708, 737, 938, 4703, 385, 408, 7512, 17005, 562, 865, 10906, 391, 20228, 4154, 8436, 385, 1595, 36280, 3346, 321, 439, 1175, 719, 585, 1383, 837, 452, 32353, 8567, 114, 4277, 594, 2899, 639, 1013, 20228, 4154, 321, 439, 970, 647, 358, 17973, 391, 3567, 611, 452, 12290, 385, 3903, 363, 2257, 938, 911, 18265, 321, 439, 1551, 8107, 707, 865, 36280, 3346, 321, 439, 1175, 5041, 1863, 24696, 881, 387, 363, 2229, 15837, 865, 1220, 752, 1714, 363, 3456, 391, 888, 358, 18103, 385, 3252, 363, 5506, 2220, 1082, 1363, 23518, 3724, 385, 3469, 363, 6052, 15837, 865, 1220, 3544, 3903, 363, 5506, 2220, 938, 644, 5010, 358, 3192, 865, 1182, 36280, 3346, 18206, 441, 938, 13786, 46370, 7329, 604, 391, 2854, 358, 1175, 385, 8601, 1197, 363, 2473, 865, 8745, 1206, 7660, 12290, 1304, 10249, 4000, 2552, 10658, 12713, 22362, 670, 1132, 22382, 3490, 2088, 938, 3749, 458, 3749, 633, 1468, 633, 2088, 1368, 705, 10307, 142, 1166, 743, 114, 1596, 484, 1175, 2854, 13786, 46370, 23330, 391, 3645, 363, 2338, 4217, 385, 1381, 363, 3192, 391, 8652, 32353, 8567, 865, 1220, 5221, 385, 13786, 46370, 806, 2220, 938, 911, 938, 440, 8505, 385, 578, 596, 707, 385, 17009, 938, 2811, 10910, 427, 440, 391, 1079, 4699, 5582, 8617, 3212, 7274, 865, 780, 7329, 604, 427, 11919, 6199, 13841, 569, 2178, 17005, 562, 23330, 2263, 391, 774, 582, 1595, 708, 712, 363, 1175, 419, 400, 571, 3243, 358, 3439, 10167, 2455, 865, 484, 1175, 5768, 363, 2716, 452, 32353, 8567, 391, 13786, 46370, 6367, 612, 15606, 865, 11315, 938, 12290, 391, 4277, 6788, 385, 1580, 2506, 391, 1595, 18265, 391, 566, 1551, 865, 1730, 503, 6259, 938, 20228, 4154, 391, 10906, 1112, 363, 3186, 23330, 391, 1595, 2736, 865, 4277, 14544, 391, 16132, 707, 865, 10906, 32796, 391, 20228, 4154, 419, 8008, 517, 4277, 938, 609, 10170, 427, 774, 419, 30088, 5898, 7482, 1890, 468, 22251, 865, 484, 1175, 31656, 938, 452, 363, 9498, 2364, 363, 6232, 385, 382, 9104, 938, 911, 363, 5935, 27370, 1112, 441, 865, 988, 441, 419, 4703, 427, 8983, 606, 391, 1879, 7614, 1783, 524, 32353, 8567, 865, 484, 1175, 3708, 32353, 8567, 385, 12290, 938, 609, 3708, 707, 358, 5402, 7369, 612, 4452, 9574, 391, 5053, 707, 385, 4144, 430, 363, 4874, 865, 1220, 4144, 430, 2351, 1332, 2788, 2507, 391, 1165, 604, 427, 363, 5402, 5010, 8732, 9574, 865, 12290, 12948, 468, 22251, 391, 2854, 32353, 8567, 865, 4418, 1612, 7660, 15239, 494, 1501, 15239, 10249, 17256, 16232, 4403, 8599, 2640, 3527, 453, 938, 3749, 458, 3749, 633, 1206, 633, 5635, 1368, 705, 10307, 142, 1586, 743, 114, 5806, 12290, 1939, 36543, 2076, 427, 363, 1175, 569, 3024, 784, 391, 12101, 32353, 8567, 865, 484, 1175, 4749, 26974, 12290, 321, 439, 1511, 938, 385, 3778, 32353, 8567, 391, 11022, 865, 1220, 24659, 452, 35978, 6708, 385, 1165, 12290, 938, 609, 656, 2838, 452, 20228, 4154, 391, 585, 1112, 42706, 391, 17709, 23330, 938, 10934, 35978, 6708, 385, 1678, 363, 1175, 1598, 385, 30088, 391, 1165, 358, 750, 17973, 865, 484, 1175, 419, 7485, 517, 30088, 6655, 391, 5582, 8617, 419, 8008, 865, 5582, 8617, 15415, 385, 11609, 36543, 391, 461, 12255, 387, 363, 3973, 865, 1220, 2998, 358, 750, 1831, 430, 363, 1175, 385, 19772, 1129, 12290, 865, 36280, 3346, 6581, 1330, 1013, 8983, 606, 385, 752, 11919, 6199, 13841, 391, 1879, 7614, 2455, 363, 1849, 391, 15841, 385, 363, 21034, 385, 19772, 452, 5582, 8617, 865, 36543, 391, 461, 12255, 5510, 385, 1595, 363, 9498, 385, 3049, 363, 10832, 865, 484, 5935, 9512, 12948, 36543, 391, 685, 6655, 979, 1879, 7614, 14544, 391, 16132, 707, 938, 452, 363, 9512, 953, 3024, 865, 1220, 1410, 461, 12255, 2767, 865, 11315, 938, 13786, 46370, 12948, 1547, 564, 33543, 430, 37844, 784, 865, 20228, 4154, 14869, 480, 42706, 321, 439, 1082, 35978, 6708, 391, 12290, 1927, 358, 44558, 938, 609, 10170, 427, 358], "start_token": 55, "end_token": 58, "category": 1}
|
{"input_ids": [65, 719, 851, 3871, 2371, 1723, 705, 1383, 604, 66, 2758, 452, 382, 16063, 1511, 2263, 576, 8983, 606, 419, 5270, 517, 363, 1745, 1082, 20323, 17652, 321, 439, 3436, 2263, 391, 12290, 792, 15415, 385, 752, 363, 3436, 865, 484, 1175, 419, 9187, 1872, 385, 3714, 8983, 606, 494, 1546, 385, 363, 1407, 2758, 865, 1220, 3544, 3954, 385, 10093, 784, 388, 363, 2285, 938, 911, 6651, 6492, 1660, 569, 736, 5385, 385, 1595, 784, 865, 8983, 606, 419, 7549, 7776, 865, 780, 3949, 6651, 6492, 1660, 391, 10598, 385, 1165, 784, 979, 9745, 363, 1372, 1598, 938, 644, 419, 12012, 517, 17652, 865, 11315, 938, 35978, 6708, 15499, 2838, 452, 708, 6722, 938, 42706, 938, 391, 5058, 938, 17709, 938, 609, 5905, 42706, 419, 708, 2903, 865, 35978, 6708, 46874, 358, 2586, 391, 718, 1738, 523, 358, 7080, 774, 651, 1914, 42706, 4372, 391, 15841, 452, 3453, 387, 1863, 430, 5324, 865, 484, 3712, 569, 1144, 604, 12290, 321, 439, 3746, 420, 784, 391, 6367, 358, 30088, 4375, 5898, 385, 3090, 566, 3745, 391, 6651, 6492, 1660, 385, 9929, 784, 865, 448, 5132, 38987, 7329, 5394, 4570, 388, 20228, 4154, 321, 439, 49285, 3552, 391, 363, 6947, 37627, 363, 2257, 391, 6471, 385, 6755, 979, 953, 7485, 517, 35978, 6708, 865, 5699, 868, 7660, 10680, 363, 7013, 6479, 10249, 45455, 418, 114, 4474, 4403, 8599, 2640, 3368, 819, 938, 3749, 458, 3749, 633, 939, 633, 9231, 1368, 705, 10307, 142, 3099, 743, 114, 2819, 20228, 4154, 4495, 10906, 385, 771, 2079, 865, 8983, 606, 34239, 12290, 385, 1112, 363, 2008, 385, 363, 3712, 2528, 387, 11917, 2263, 391, 12290, 1939, 363, 6947, 14342, 363, 4742, 420, 784, 865, 484, 1175, 23761, 427, 1547, 564, 33543, 938, 363, 1407, 2758, 13930, 938, 419, 3159, 388, 10224, 9722, 938, 1082, 585, 490, 8082, 517, 4277, 387, 20228, 4154, 321, 439, 33136, 865, 36280, 3346, 938, 8983, 606, 391, 7560, 725, 2753, 385, 1165, 20228, 4154, 1082, 363, 1955, 3168, 385, 9722, 865, 5582, 8617, 5053, 11919, 6199, 13841, 387, 36280, 3346, 321, 439, 4107, 938, 644, 23061, 385, 745, 3024, 612, 2903, 480, 427, 2580, 865, 484, 2758, 419, 7776, 19085, 2263, 576, 17652, 321, 439, 30836, 12408, 2583, 388, 6179, 363, 3436, 865, 11315, 938, 36280, 3346, 321, 439, 1175, 23761, 427, 363, 970, 474, 358, 475, 2005, 517, 20228, 4154, 2263, 792, 8983, 606, 15415, 385, 6755, 865, 20228, 4154, 3487, 36280, 3346, 385, 475, 30513, 15241, 363, 30982, 7205, 388, 363, 9574, 387, 363, 1593, 865, 8983, 606, 7329, 363, 2257, 517, 363, 15573, 4511, 2263, 576, 585, 490, 1642, 3851, 456, 10906, 13590, 363, 4511, 388, 741, 865, 10906, 12948, 448, 5132, 38987, 456, 358, 13142, 865, 36280, 3346, 15415, 385, 1945, 363, 30982, 391, 6084, 20228, 4154, 385, 382, 11548, 17636, 517, 20228, 4154, 321, 439, 2708, 388, 503, 6259, 865, 8983, 606, 14544, 391, 20228, 4154, 419, 9071, 388, 358, 2220, 865, 36280, 3346, 3112, 358, 970, 523, 10906, 938, 609, 24620, 5324, 363, 2288, 741, 865, 6236, 908, 7660, 484, 7987, 10249, 17256, 16232, 11621, 29862, 3368, 1261, 938, 3749, 458, 3749, 633, 939, 633, 1261, 1368, 705, 10307, 142, 3020, 743, 114, 2332, 10906, 1939, 358, 39955, 452, 36280, 3346, 938, 3602, 784, 363, 1435, 387, 363, 9574, 391, 20228, 4154, 419, 2817, 865, 1220, 5510, 385, 771, 2079, 385, 2323, 967, 363, 5935, 865, 5582, 8617, 5745, 382, 1469, 420, 13786, 46370, 806, 1198, 391, 2364, 363, 1039, 2758, 938, 644, 419, 6426, 865, 17652, 419, 3451, 604, 387, 363, 1511, 881, 387, 566, 30836, 12408, 427, 8825, 388, 6179, 363, 3436, 865, 780, 4495, 363, 1175, 321, 439, 33136, 385, 6651, 6492, 1660, 388, 5264, 430, 1738, 391, 17122, 566, 19749, 517, 3602, 363, 1175, 321, 439, 1511, 1598, 938, 7287, 388, 1879, 7614, 953, 19576, 2924, 938, 3126, 14230, 11919, 6199, 13841, 12545, 385, 865, 17652, 3026, 385, 1927, 6651, 6492, 1660, 938, 609, 20712, 391, 7720, 1043, 784, 385, 1661, 363, 1175, 321, 439, 4168, 865, 11237, 4041, 17652, 517, 358, 30114, 36280, 3346, 1335, 388, 566, 13325, 938, 363, 1175, 14544, 391, 551, 6178, 1013, 6651, 6492, 1660, 938, 2607, 5576, 523, 4000, 5768, 17652, 385, 33606, 385, 566, 14230, 865, 11315, 938, 18265, 8505, 385, 1595, 20228, 4154, 456, 440, 8173, 2263, 576, 10906, 3164, 17487, 784, 385, 1678, 707, 618, 741, 865, 20228, 4154, 6581, 1330, 1013, 4277, 385, 9262, 363, 1955, 865, 11919, 6199, 13841, 19432, 3016, 452, 10906, 881, 387, 363, 1175, 865, 35124, 25749, 427, 363, 2331, 474, 430, 566, 2758, 508, 566, 1305, 938, 13786, 46370, 13368, 385, 4452, 32353, 8567, 865, 8031, 961, 7660, 3979, 1209, 26320, 39692, 10249, 18134, 448, 5475, 1174, 8148, 10945, 5900, 3490, 614, 938, 3749, 458, 3749, 633, 1468, 633, 7744, 1368, 705, 10307, 142, 3032, 743, 114, 2055, 484, 1175, 7720, 1043, 6651, 6492, 1660, 385, 888, 784, 1661, 13786, 46370, 427, 585, 490, 2737, 1082, 12275, 8983, 606, 523, 2364, 566, 15928, 1667, 363, 28738, 419, 1861, 865, 11919, 6199, 13841, 419, 7248, 385, 11609, 6651, 6492, 1660, 2263, 576, 774, 10244, 865, 733, 419, 4703, 385, 408, 358, 1511, 385, 1801, 566, 3910, 1363, 1281, 2557, 391, 12290, 456, 43717, 7790, 984, 2557, 938, 1743, 358, 6928, 12417, 363, 4466, 321, 439, 29441, 938, 644, 12290, 5442, 385, 13786, 46370, 420, 363, 3173, 2263, 391, 440, 3112, 22699, 391, 370, 1293, 1525, 363, 7634, 5298, 440, 6128, 865, 8983, 606, 7720, 1043, 6651, 6492, 1660, 1667, 440, 14487, 385, 5012, 17130, 385, 24598, 938, 807, 644, 440, 419, 3024, 865, 11315, 938, 2736, 5041, 10341, 448, 5132, 38987, 321, 439, 22476, 2263, 576, 20228, 4154, 39208, 363, 3175, 517, 29450, 363, 4507, 938, 4579, 363, 5394, 4570, 388, 448, 5132, 38987, 321, 439, 3552, 938, 1743, 2736, 385, 2070, 363, 1440, 388, 1603, 385, 3049, 363, 10832, 865, 10906, 5830, 19432, 3016, 452, 13786, 46370, 938, 4703, 385, 524, 688, 3051, 452, 784, 979, 865, 1476, 7329, 604, 647, 363, 4452, 865, 484, 1175, 7329, 358, 1761, 12757, 12114, 612, 936, 391, 15415, 385, 752, 2074, 441, 938, 576, 480, 363, 1676, 387, 7560, 725, 321, 439, 1305, 865, 8376, 939, 7660, 484, 9984, 10249, 30003, 468, 114, 7804, 610, 38722, 4122, 473, 3490, 939, 938, 3749, 458, 3749, 633, 1468, 633, 939, 1368, 705, 10307, 142, 1041, 743, 114, 2649, 484, 1175, 3487, 12290, 385, 8652, 7560, 725, 321, 439, 1868, 391, 3859, 441, 385, 566, 2903, 865, 1879, 7614, 10170, 427, 440, 662, 524, 3825, 388, 363, 412, 4551, 16453, 938, 854, 964, 517, 20228, 4154, 938, 712, 7560, 725, 651, 400, 571, 7549, 363, 2067, 865, 10906, 30476, 363, 1175, 387, 13786, 46370, 806, 1511, 865, 1220, 6638, 427, 585, 1376, 400, 571, 15873, 363, 30982, 1332, 363, 8278, 865, 1220, 1165, 382, 7169, 321, 439, 1539, 388, 363, 9574, 2263, 391, 8983, 606, 3026, 385, 363, 7169, 321, 439, 2257, 938, 911, 13786, 46370, 569, 2009, 566, 999, 1551, 385, 8652, 363, 7169, 430, 566, 1511, 865, 484, 1175, 7329, 18547, 388, 358, 2220, 585, 3252, 420, 612, 936, 865, 1879, 7614, 7685, 566, 2467, 420, 358, 6265, 938, 644, 582, 20514, 479, 807, 363, 2467, 419, 6055, 865, 10906, 8505, 385, 926, 2005, 441, 865, 8983, 606, 46874, 363, 8278, 391, 15415, 385, 926, 2005, 363, 6265, 391, 3714, 1879, 7614, 865, 20228, 4154, 23761, 427, 4277, 419, 7071, 618, 722, 3039, 865, 780, 3112, 708, 970, 7982, 391, 7329, 604, 427, 774, 419, 388, 2901, 452, 12290, 865, 11315, 938, 36280, 3346, 419, 14742, 452, 48742, 25610, 488, 13923, 6187, 391, 11919, 6199, 13841, 2686, 427, 440, 582, 4757, 712, 440, 958, 400, 571, 524, 358, 8286, 2683, 865, 8358, 1468, 7660, 37456, 24629, 10249, 8040, 468, 31186, 20295, 29111, 3490, 1697, 938, 3749, 458, 3749, 633, 1468, 633, 1697, 1368, 705, 10307, 142, 1258, 743, 114, 4410, 36280, 3346, 1587, 790, 363, 1511, 430, 363, 1175, 938, 456, 440, 582, 508, 4755, 707, 881, 387, 566, 8286, 865, 10906, 5341, 6332, 358, 2050, 402, 452, 13786, 46370, 938, 388, 644, 774, 8505, 385, 8812, 566, 2758, 2263, 576, 440, 1642, 4307, 391, 8505, 385, 1595, 708, 979, 774, 17704, 784, 387, 612, 1301, 2263, 391, 440, 700, 3666, 708, 391, 5768, 865, 36280, 3346, 13368, 385, 4755, 363, 1175, 391, 5562, 363, 4466, 979, 8286, 2263, 391, 11919, 6199, 13841, 3026, 385, 567, 708, 737, 938, 4703, 385, 408, 7512, 17005, 562, 865, 10906, 391, 20228, 4154, 8436, 385, 1595, 36280, 3346, 321, 439, 1175, 719, 585, 1383, 837, 452, 32353, 8567, 114, 4277, 594, 2899, 639, 1013, 20228, 4154, 321, 439, 970, 647, 358, 17973, 391, 3567, 611, 452, 12290, 385, 3903, 363, 2257, 938, 911, 18265, 321, 439, 1551, 8107, 707, 865, 36280, 3346, 321, 439, 1175, 5041, 1863, 24696, 881, 387, 363, 2229, 15837, 865, 1220, 752, 1714, 363, 3456, 391, 888, 358, 18103, 385, 3252, 363, 5506, 2220, 1082, 1363, 23518, 3724, 385, 3469, 363, 6052, 15837, 865, 1220, 3544, 3903, 363, 5506, 2220, 938, 644, 5010, 358, 3192, 865, 1182, 36280, 3346, 18206, 441, 938, 13786, 46370, 7329, 604, 391, 2854, 358, 1175, 385, 8601, 1197, 363, 2473, 865, 8745, 1206, 7660, 12290, 1304, 10249, 4000, 2552, 10658, 12713, 22362, 670, 1132, 22382, 3490, 2088, 938, 3749, 458, 3749, 633, 1468, 633, 2088, 1368, 705, 10307, 142, 1166, 743, 114, 1596, 484, 1175, 2854, 13786, 46370, 23330, 391, 3645, 363, 2338, 4217, 385, 1381, 363, 3192, 391, 8652, 32353, 8567, 865, 1220, 5221, 385, 13786, 46370, 806, 2220, 938, 911, 938, 440, 8505, 385, 578, 596, 707, 385, 17009, 938, 2811, 10910, 427, 440, 391, 1079, 4699, 5582, 8617, 3212, 7274, 865, 780, 7329, 604, 427, 11919, 6199, 13841, 569, 2178, 17005, 562, 23330, 2263, 391, 774, 582, 1595, 708, 712, 363, 1175, 419, 400, 571, 3243, 358, 3439, 10167, 2455, 865, 484, 1175, 5768, 363, 2716, 452, 32353, 8567, 391, 13786, 46370, 6367, 612, 15606, 865, 11315, 938, 12290, 391, 4277, 6788, 385, 1580, 2506, 391, 1595, 18265, 391, 566, 1551, 865, 1730, 503, 6259, 938, 20228, 4154, 391, 10906, 1112, 363, 3186, 23330, 391, 1595, 2736, 865, 4277, 14544, 391, 16132, 707, 865, 10906, 32796, 391, 20228, 4154, 419, 8008, 517, 4277, 938, 609, 10170, 427, 774, 419, 30088, 5898, 7482, 1890, 468, 22251, 865, 484, 1175, 31656, 938, 452, 363, 9498, 2364, 363, 6232, 385, 382, 9104, 938, 911, 363, 5935, 27370, 1112, 441, 865, 988, 441, 419, 4703, 427, 8983, 606, 391, 1879, 7614, 1783, 524, 32353, 8567, 865, 484, 1175, 3708, 32353, 8567, 385, 12290, 938, 609, 3708, 707, 358, 5402, 7369, 612, 4452, 9574, 391, 5053, 707, 385, 4144, 430, 363, 4874, 865, 1220, 4144, 430, 2351, 1332, 2788, 2507, 391, 1165, 604, 427, 363, 5402, 5010, 8732, 9574, 865, 12290, 12948, 468, 22251, 391, 2854, 32353, 8567, 865, 4418, 1612, 7660, 15239, 494, 1501, 15239, 10249, 17256, 16232, 4403, 8599, 2640, 3527, 453, 938, 3749, 458, 3749, 633, 1206, 633, 5635, 1368, 705, 10307, 142, 1586, 743, 114, 5806, 12290, 1939, 36543, 2076, 427, 363, 1175, 569, 3024, 784, 391, 12101, 32353, 8567, 865, 484, 1175, 4749, 26974, 12290, 321, 439, 1511, 938, 385, 3778, 32353, 8567, 391, 11022, 865, 1220, 24659, 452, 35978, 6708, 385, 1165, 12290, 938, 609, 656, 2838, 452, 20228, 4154, 391, 585, 1112, 42706, 391, 17709, 23330, 938, 10934, 35978, 6708, 385, 1678, 363, 1175, 1598, 385, 30088, 391, 1165, 358, 750, 17973, 865, 484, 1175, 419, 7485, 517, 30088, 6655, 391, 5582, 8617, 419, 8008, 865, 5582, 8617, 15415, 385, 11609, 36543, 391, 461, 12255, 387, 363, 3973, 865, 1220, 2998, 358, 750, 1831, 430, 363, 1175, 385, 19772, 1129, 12290, 865, 36280, 3346, 6581, 1330, 1013, 8983, 606, 385, 752, 11919, 6199, 13841, 391, 1879, 7614, 2455, 363, 1849, 391, 15841, 385, 363, 21034, 385, 19772, 452, 5582, 8617, 865, 36543, 391, 461, 12255, 5510, 385, 1595, 363, 9498, 385, 3049, 363, 10832, 865, 484, 5935, 9512, 12948, 36543, 391, 685, 6655, 979, 1879, 7614, 14544, 391, 16132, 707, 938, 452, 363, 9512, 953, 3024, 865, 1220, 1410, 461, 12255, 2767, 865, 11315, 938, 13786, 46370, 12948, 1547, 564, 33543, 430, 37844, 784, 865, 20228, 4154, 14869, 480, 42706, 321, 439, 1082, 35978, 6708, 391, 12290, 1927, 358, 44558, 938, 609, 10170, 427, 358, 3805, 387, 32353, 8567, 419, 4915, 865, 12290, 3949, 36280, 3346, 391, 8766, 441, 938, 609, 926, 545, 784, 385, 1383, 391, 752, 441, 865, 9267, 1579, 7660, 2430, 7421, 10249, 3041, 468, 7147, 7628, 11621, 29862, 3527, 908, 938, 3749, 458, 3749, 633, 1206, 633, 8588, 1368, 705, 10307, 142, 1516, 743, 114, 1922, 484, 1175, 26079, 430, 12290, 321, 439, 1469, 865, 1220, 8107, 12290, 938, 609, 3164, 17487, 707, 385, 1410, 784, 3778, 32353, 8567, 391, 363, 5935, 582, 408, 6673, 7050, 865, 1220, 1410, 784, 2767, 938, 1082, 1879, 7614, 30869, 388, 566, 21528, 865, 12290, 391, 35978, 6708, 9341, 388, 358, 44505, 391, 1879, 7614, 30476, 363, 1955, 938, 609, 9341, 391, 1469, 363, 18646, 865, 36280, 3346, 321, 439, 4107, 1939, 784, 9908, 2263, 391, 363, 18646, 6755, 865, 484, 5935, 46874, 36280, 3346, 865, 11237, 1335, 358, 4777, 388, 363, 21034, 938, 12290, 7329, 911, 36280, 3346, 569, 7205, 363, 3805, 391, 1010, 12244, 441, 979, 4686, 363, 44558, 865, 11315, 938, 20228, 4154, 419, 8773, 517, 358, 683, 23763, 385, 408, 358, 41270, 42515, 865, 484, 2067, 3544, 13368, 385, 1410, 42706, 391, 17709, 6755, 391, 419, 8008, 517, 363, 683, 938, 609, 419, 358, 5935, 683, 388, 1210, 865, 12290, 11286, 391, 12948, 363, 44558, 388, 1603, 385, 1495, 363, 2288, 1738, 865, 8983, 606, 11286, 5450, 6655, 16433, 391, 27613, 938, 609, 561, 7365, 363, 1175, 17090, 388, 5264, 430, 32353, 8567, 865, 484, 6947, 14895, 363, 2067, 807, 4955, 427, 32353, 8567, 419, 3851, 865, 17005, 562, 682, 429, 6008, 523, 363, 5935, 865, 5582, 8617, 1939, 358, 1831, 452, 13786, 46370, 385, 1542, 32353, 8567, 388, 5264, 430, 36280, 3346, 321, 439, 8286, 865, 7825, 1416, 7660, 19320, 4799, 10249, 18779, 503, 716, 30393, 30819, 10163, 12870, 3527, 1416, 938, 3749, 458, 3749, 633, 1206, 633, 1416, 1368, 705, 10307, 142, 1415, 743, 114, 2819, 5582, 8617, 7720, 1043, 20228, 4154, 391, 7329, 12290, 391, 10906, 321, 439, 33136, 865, 484, 2067, 391, 1879, 7614, 9341, 480, 363, 4168, 2263, 576, 585, 490, 1642, 3851, 865, 1220, 1495, 10443, 1363, 363, 5935, 321, 439, 8553, 3138, 391, 2711, 363, 18646, 385, 358, 1396, 911, 585, 490, 3350, 363, 17973, 321, 439, 390, 24522, 906, 938, 4847, 865, 484, 6947, 2854, 32353, 8567, 391, 32796, 1082, 12290, 391, 10906, 490, 8008, 865, 11315, 938, 36280, 3346, 3026, 840, 8286, 391, 11286, 2789, 4592, 8923, 388, 566, 4421, 938, 911, 440, 15415, 385, 4749, 7335, 745, 32353, 8567, 1208, 419, 865, 484, 5006, 419, 4489, 391, 36280, 3346, 10170, 385, 11919, 6199, 13841, 427, 32353, 8567, 5010, 1407, 10540, 8615, 427, 561, 987, 363, 2669, 5003, 391, 2249, 15642, 2669, 2263, 391, 427, 419, 1622, 13786, 46370, 5905, 32353, 8567, 385, 408, 363, 2824, 387, 1277, 865, 8983, 606, 32796, 363, 4452, 1198, 391, 16433, 10012, 784, 2263, 576, 440, 3164, 17487, 708, 385, 1410, 784, 2767, 865, 1879, 7614, 491, 42733, 391, 13786, 46370, 3487, 5582, 8617, 385, 1175, 611, 452, 12290, 938, 10906, 391, 20228, 4154, 388, 1603, 385, 8652, 32353, 8567, 865, 36280, 3346, 34162, 5582, 8617, 430, 566, 2652, 391, 363, 6947, 10170, 427, 612, 2903, 3212, 430, 363, 5935, 391, 440, 582, 2656, 363, 1742, 1698, 865, 8955, 1568, 7660, 484, 32311, 1913, 10249, 8040, 468, 31186, 4806, 6645, 177, 28145, 1323, 20421, 22274, 11425, 3527, 2635, 938, 3749, 458, 3749, 633, 1206, 633, 2635, 1368, 705, 10307, 142, 1534, 705, 114, 4190, 5582, 8617, 806, 1175, 14544, 388, 8538, 938, 911, 4847, 569, 688, 18384, 385, 865, 12290, 6471, 385, 2801, 358, 3116, 385, 491, 3556, 5582, 8617, 456, 363, 6579, 391, 1112, 363, 2393, 938, 576, 441, 419, 2570, 616, 517, 8983, 606, 321, 439, 10426, 865, 484, 1175, 1010, 12244, 8553, 9741, 644, 10906, 44947, 391, 7329, 4847, 938, 576, 774, 958, 400, 571, 4276, 363, 1175, 391, 5341, 6332, 358, 3350, 452, 4847, 420, 708, 999, 865, 11315, 938, 4000, 34368, 611, 388, 358, 25809, 24242, 911, 358, 5935, 31308, 30476, 784, 427, 566, 2903, 938, 33774, 8150, 36280, 3346, 938, 419, 1092, 6877, 391, 1863, 430, 363, 5935, 865, 4000, 8766, 385, 1662, 385, 708, 938, 576, 363, 31308, 20717, 427, 585, 582, 1662, 719, 440, 13368, 385, 4755, 363, 5935, 865, 11919, 6199, 13841, 11286, 17005, 562, 938, 609, 3708, 708, 4000, 321, 439, 33136, 865, 13786, 46370, 3708, 6367, 430, 4000, 385, 408, 1914, 358, 3416, 3614, 427, 815, 1595, 784, 938, 576, 644, 582, 3830, 2566, 566, 2101, 2263, 2259, 938, 440, 15415, 385, 6755, 452, 11919, 6199, 13841, 321, 439, 1138, 865, 780, 5053, 11919, 6199, 13841, 427, 440, 5905, 566, 2903, 419, 6877, 865, 10906, 2854, 363, 1175, 385, 358, 4168, 911, 585, 490, 5016, 7575, 517, 4847, 321, 439, 1551, 865, 10906, 2559, 5490, 858, 938, 953, 2924, 517, 4847, 938, 609, 419, 3024, 1964, 452, 566, 1551, 865, 10906, 419, 1465, 430, 363, 1745, 865, 5582, 8617, 7530, 363, 970, 523, 363, 17973, 938, 609, 419, 33774, 865, 9016, 1697, 7660, 484, 10685, 507, 1199, 10249, 11333, 12259, 1109, 20295, 29111, 3136, 1697, 938, 3818, 458, 3818, 633, 8803, 633, 1697, 1368, 705, 10307, 142, 1659, 614, 114, 2783, 5582, 8617, 806, 1175, 1967, 3429, 4364, 387, 612, 6252, 3493, 938, 2009, 517, 13786, 46370, 385, 888, 707, 5562, 363, 4466, 865, 1220, 8689, 358, 2142, 2095, 6593, 523, 4847, 865, 1220, 2711, 441, 391, 1165, 835, 7165, 441, 419, 1074, 865, 12290, 391, 20228, 4154, 568, 430, 631, 427, 419, 388, 358, 5029, 2263, 576, 585, 490, 508, 3243, 2742, 865, 5582, 8617, 391, 8983, 606, 9341, 388, 358, 2257, 911, 585, 42898, 358, 3376, 33774, 569, 1465, 430, 5582, 8617, 911, 385, 1927, 708, 865, 5582, 8617, 11286, 33774, 388, 358, 7173, 938, 911, 774, 7994, 784, 385, 1678, 708, 741, 385, 7534, 13786, 46370, 938, 4251, 541, 1019, 6471, 385, 1595, 456, 708, 1511, 865, 1476, 569, 541, 1019, 3024, 430, 363, 5388, 938, 1743, 13786, 46370, 4200, 708, 865, 484, 685, 1216, 1469, 363, 5029, 391, 1165, 6642, 391, 2142, 2095, 27862, 713, 865, 11315, 938, 4000, 391, 11919, 6199, 13841, 7909, 388, 358, 7880, 9188, 385, 8538, 865, 1220, 490, 7485, 517, 358, 683, 938, 609, 419, 7485, 391, 10665, 807, 12417, 427, 440, 958, 400, 571, 771, 430, 13786, 46370, 865, 4000, 46874, 382, 19466, 3566, 523, 784, 865, 5582, 8617, 13368, 385, 1927, 33774, 858, 938, 745, 774, 17868, 784, 508, 385, 865, 6761, 774, 6367, 358, 26261, 385, 2787, 784, 865, 5542, 1349, 7660, 22370, 865, 10249, 30003, 468, 114, 7804, 4403, 8599, 2640, 1323, 12713, 22362, 670, 1132, 22382, 3136, 2088, 938, 3818, 458, 3818, 633, 8803, 633, 2088, 1368, 705, 10307, 142, 1608, 614, 114, 3413, 484, 1175, 16132, 5582, 8617, 391, 12948, 363, 26261, 865, 4000, 391, 11919, 6199, 13841, 14544, 388, 8538, 938, 911, 585, 1927, 8983, 606, 391, 1661, 784, 427, 585, 582, 4218, 363, 5935, 746, 2401, 363, 1676, 938, 1743, 363, 835, 3567, 2886, 5876, 865, 5582, 8617, 806, 1175, 8440, 33774, 385, 363, 4043, 18714, 391, 3903, 441, 480, 363, 1676, 387, 20228, 4154, 953, 13226, 865, 33774, 3164, 17487, 13345, 6530, 9100, 24056, 34690, 938, 358, 15072, 938, 385, 1662, 647, 32353, 8567, 388, 363, 7966, 2669, 4596, 938, 11882, 784, 385, 1112, 1438, 387, 358, 11545, 3807, 3938, 19971, 523, 6767, 5977, 865, 5582, 8617, 806, 1175, 46874, 358, 3566, 523, 363, 18714, 865, 4000, 391, 11919, 6199, 13841, 42898, 612, 3566, 391, 9341, 480, 363, 9104, 3938, 19971, 321, 439, 6715, 419, 9682, 865, 5582, 8617, 806, 1175, 14544, 1266, 391, 24928, 3938, 19971, 1082, 363, 18646, 1112, 566, 2786, 3173, 938, 20161, 427, 440, 569, 688, 388, 2901, 452, 33774, 938, 358, 1725, 440, 18967, 719, 2066, 517, 5582, 8617, 806, 1175, 865, 20228, 4154, 17449, 30476, 13786, 46370, 427, 33774, 569, 32353, 8567, 2263, 391, 440, 13368, 385, 568, 385, 8538, 7721, 865, 4000, 3949, 33774, 938, 609, 8505, 385, 1839, 452, 784, 2263, 576, 440, 28188, 611, 865, 11919, 6199, 13841, 7329, 604, 427, 774, 419, 10524, 865, 8785, 779, 7660, 412, 114, 147, 114, 134, 114, 10249, 45455, 418, 114, 4474, 610, 38722, 4122, 473, 1838, 453, 938, 3818, 458, 3818, 633, 8971, 633, 5635, 1368, 705, 10307, 142, 1230, 614, 114, 1339, 4000, 3949, 33774, 858, 391, 774, 15415, 385, 2711, 784, 865, 1476, 14544, 452, 708, 1551, 2263, 576, 529, 474, 4703, 385, 408, 358, 475, 2005, 517, 4000, 938, 609, 1964, 452, 11919, 6199, 13841, 24928, 708, 391, 2767, 865, 13786, 46370, 14544, 391, 34162, 5582, 8617, 430, 508, 5250, 784, 647, 33774, 865, 780, 3708, 363, 1175, 938, 23595, 20228, 4154, 938, 1295, 2964, 2263, 391, 585, 568, 385, 358, 2257, 391, 889, 358, 3432, 385, 12932, 358, 45492, 2263, 576, 585, 6638, 427, 441, 474, 756, 2178, 2263, 391, 585, 1678, 15606, 865, 11315, 938, 33774, 10170, 385, 4000, 427, 5582, 8617, 419, 508, 566, 2182, 4057, 391, 1079, 4699, 8298, 5582, 8617, 719, 440, 2727, 566, 3498, 938, 609, 3212, 430, 363, 5935, 865, 1476, 736, 10170, 427, 5582, 8617, 419, 7564, 388, 358, 12941, 774, 569, 1001, 2263, 391, 4000, 38697, 385, 3714, 5582, 8617, 979, 22757, 708, 865, 1476, 7329, 604, 647, 363, 5257, 979, 22757, 11919, 6199, 13841, 391, 25172, 865, 20228, 4154, 12948, 3938, 19971, 420, 13786, 46370, 806, 1603, 865, 5582, 8617, 806, 1175, 8440, 363, 683, 385, 363, 2669, 4596, 938, 911, 5582, 8617, 14271, 979, 9100, 24056, 34690, 419, 40082, 391, 5582, 8617, 419, 23766, 430, 441, 865, 4000, 14544, 391, 3567, 611, 452, 784, 865, 8642, 1261, 7660, 16636, 1323, 12847, 10249, 21675, 428, 20443, 27187, 8148, 10945, 5900, 1838, 908, 938, 3818, 458, 3818, 633, 8971, 633, 8588, 1368, 705, 10307, 142, 1339, 463, 114, 2180, 4000, 391, 5582, 8617, 6755, 385, 631, 387, 363, 18671, 865, 33774, 1939, 358, 1831, 452, 363, 4043, 5638, 4240, 938, 609, 474, 736, 9100, 24056, 34690, 321, 439, 3089, 938, 385, 3778, 784, 32353, 8567, 865, 12290, 5053, 4000, 391, 5582, 8617, 804, 363, 1745, 419, 1117, 385, 8107, 707, 391, 12948, 358, 30088, 5898, 609, 10323, 784, 865, 4000, 7329, 358, 3854, 1427, 5116, 391, 585, 6755, 363, 9375, 4427, 938, 576, 490, 13590, 517, 363, 10755, 938, 609, 419, 3024, 517, 13786, 46370, 806, 28710, 938, 609, 23108, 363, 18646, 865, 8983, 606, 378, 6138, 11919, 6199, 13841, 391, 30476, 4000, 938, 609, 419, 3282, 385, 13786, 46370, 452, 363, 1955, 865, 13786, 46370, 4101, 5715, 707, 517, 9590, 358, 22199, 865, 12290, 419, 6598, 391, 13786, 46370, 569, 12290, 321, 439, 3757, 3024, 391, 12290, 32796, 938, 576, 419, 19576, 2924, 865, 4000, 938, 5582, 8617, 391, 8983, 606, 1165, 33774, 391, 1112, 32353, 8567, 2263, 576, 5582, 8617, 419, 8008, 865, 20228, 4154, 938, 609, 48356, 4000, 391, 8983, 606, 321, 439, 5374, 938, 23108, 11919, 6199, 13841, 391, 6875, 708, 385, 13786, 46370, 938, 609, 3949, 4000, 391, 8766, 32353, 8567, 388, 5264, 430, 708, 865, 33774, 3949, 4000, 391, 1939, 363, 1077, 3613, 388, 5264, 430, 5582, 8617, 938, 19576, 4496, 784, 385, 2801, 4000, 385, 23391, 865, 8800, 2411, 7660, 14907, 387, 12617, 10249, 17256, 16232, 30819, 10163, 12870, 1838, 1416, 938, 3818, 458, 3818, 633, 8971, 633, 1416, 1368, 705, 10307, 142, 2582, 614, 114, 2725, 2994, 6256, 388, 363, 6584, 387, 4943, 938, 1879, 7614, 11286, 14634, 14122, 938, 609, 10170, 427, 713, 419, 358, 683, 938, 1545, 3463, 938, 609, 569, 1150, 1277, 391, 419, 3593, 385, 7365, 4000, 391, 363, 1955, 17090, 388, 5264, 430, 32353, 8567, 865, 4000, 5341, 6332, 358, 4168, 452, 33774, 391, 8505, 385, 1595, 708, 713, 2263, 576, 363, 1745, 9341, 391, 1212, 4772, 6755, 865, 5582, 8617, 5053, 4000, 647, 363, 5257, 391, 7994, 784, 385, 1410, 784, 4757, 865, 33774, 14855, 363, 1831, 452, 9100, 24056, 34690, 881, 387, 5388, 385, 5304, 32353, 8567, 865, 8983, 606, 5830, 832, 20578, 4000, 391, 3949, 33774, 938, 1743, 358, 1831, 385, 2323, 32353, 8567, 388, 5264, 430, 566, 3757, 938, 24598, 938, 953, 7549, 523, 363, 5935, 865, 4000, 5341, 6332, 358, 8712, 452, 13786, 46370, 938, 609, 5768, 1332, 11919, 6199, 13841, 938, 39040, 385, 1595, 4000, 807, 2364, 32353, 8567, 865, 20228, 4154, 8505, 385, 7363, 708, 2263], "start_token": -100, "end_token": -100, "category": 0}
|
{"input_ids": [65, 609, 474, 363, 2989, 387, 363, 39485, 10575, 523, 376, 38506, 66, 724, 5404, 938, 676, 1178, 43050, 43055, 938, 7668, 46904, 444, 14504, 9645, 11430, 938, 507, 6182, 26320, 701, 7532, 938, 500, 493, 36784, 938, 8629, 8060, 14504, 938, 503, 25212, 24898, 30401, 14737, 14504, 8353, 49686, 444, 938, 6967, 27556, 468, 2825, 422, 14504, 938, 6967, 27556, 448, 8649, 5641, 14504, 20392, 938, 6967, 27556, 11839, 38107, 14504, 507, 1320, 5009, 17280, 49729, 35086, 664, 4299, 1329, 4535, 45402, 1159, 22868, 462, 30675, 17460, 938, 418, 11733, 8327, 26206, 12073, 3869, 938, 1153, 1119, 11493, 13697, 23032, 10985, 3200, 938, 9100, 24056, 13497, 451, 8948, 425, 550, 20189, 174, 13516, 47617, 6182, 938, 16682, 464, 47362, 451, 8948, 425, 938, 448, 14752, 2651, 507, 38105, 938, 1810, 1329, 5170, 5868, 451, 8948, 425, 938, 20732, 9333, 7532, 938, 610, 114, 152, 114, 18482, 938, 6346, 48387, 32708, 3510, 5011, 938, 44046, 11114, 3302, 10985, 3200, 938, 503, 1030, 38107, 877, 14504, 938, 550, 425, 650, 605, 23083, 424, 938, 13891, 41369, 11114, 3302, 36784, 938, 35788, 174, 13910, 7532, 938, 13891, 8622, 14504, 438, 46636, 938, 12771, 5170, 5868, 14504, 387, 7592, 34470, 16585, 938, 12771, 2141, 36700, 2844, 451, 8948, 425, 41550, 716, 938, 8983, 5170, 451, 8948, 425, 10985, 3200, 938, 38695, 448, 30416, 34470, 23083, 424, 938, 38101, 20189, 42610, 451, 8948, 425, 938, 13409, 48387, 451, 8948, 425, 938, 7532, 5170, 5868, 451, 8948, 425, 10985, 3200, 938, 7532, 24056, 23032, 14504, 938, 20779, 455, 27711, 5383, 10985, 3200, 938, 412, 19274, 21388, 9970, 10985, 3200, 938, 7132, 4073, 24056, 23032, 10985, 3200, 938, 20929, 45662, 493, 550, 3200, 938, 451, 114, 143, 114, 2412, 938, 20973, 38695, 10985, 3200, 938, 20973, 13697, 23032, 8983, 12999, 938, 1733, 10647, 42610, 14237, 45157, 938, 47778, 38487, 938, 1733, 377, 13891, 16471, 38487, 938, 507, 7347, 39017, 46712, 938, 29775, 26394, 444, 938, 12041, 39260, 478, 47778, 938, 41800, 35086, 664, 418, 14166, 47778, 865, 468, 9549, 50273, 14237, 45157, 5795, 7619, 17487, 391, 1456, 20141, 1159, 12558, 4071, 710, 19274, 1012, 2825, 5132, 938, 38101, 13516, 670, 8805, 938, 13409, 175, 489, 2844, 1804, 900, 610, 3000, 938, 448, 114, 133, 114, 1970, 25505, 23114, 938, 25967, 20463, 383, 18109, 25505, 383, 448, 7846, 3317, 938, 410, 43674, 434, 428, 23717, 447, 383, 938, 20295, 1615, 50273, 29634, 938, 468, 2844, 14504, 503, 555, 938, 468, 2844, 37001, 28904, 11712, 11119, 938, 15718, 455, 16019, 13891, 44371, 26537, 5412, 40105, 21171, 938, 12073, 605, 12215, 422, 14504, 42196, 938, 47483, 906, 412, 11941, 43105, 448, 5284, 21171, 938, 6062, 6693, 1772, 5589, 19514, 43496, 5589, 461, 5170, 30401, 14737, 938, 472, 15921, 14967, 21171, 1012, 2825, 5132, 938, 472, 114, 143, 114, 15739, 35086, 6963, 938, 14967, 21171, 934, 14208, 562, 461, 29256, 24512, 1235, 2844, 938, 5379, 10054, 938, 610, 7862, 1733, 377, 11712, 3137, 44109, 938, 23308, 9058, 2314, 5589, 22355, 1182, 37788, 1159, 49633, 19274, 46396, 10224, 21171, 938, 20630, 19274, 413, 9970, 448, 27446, 633, 438, 35655, 938, 1615, 11736, 877, 25755, 450, 23114, 938, 550, 114, 142, 114, 145, 114, 38504, 633, 9918, 938, 12655, 9536, 9970, 710, 7445, 3200, 938, 32795, 5463, 26206, 49729, 35086, 1702, 938, 15971, 10419, 425, 48073, 938, 17971, 434, 472, 37217, 1572, 13909, 1159, 38146, 8250, 877, 29634, 938, 38695, 46396, 503, 1329, 600, 7347, 11114, 2534, 2372, 6346, 938, 9499, 37919, 37458, 2717, 438, 12337, 8759, 938, 507, 998, 177, 22151, 23032, 412, 12297, 6807, 27642, 877, 14237, 45157, 938, 500, 493, 4207, 14741, 29634, 938, 13409, 175, 37619, 2717, 448, 678, 938, 10945, 42458, 26206, 29634, 938, 10706, 35086, 781, 444, 14237, 45157, 12618, 1159, 461, 5170, 166, 5094, 13516, 42196, 22129, 748, 633, 2286, 31754, 3402, 1159, 31610, 416, 8537, 49674, 36784, 16682, 954, 4271, 1867, 2499, 1159, 428, 114, 145, 114, 451, 2150, 34619, 438, 994, 483, 1159, 610, 114, 135, 114, 472, 21975, 938, 410, 114, 44588, 14515, 5009, 21109, 938, 468, 114, 150, 114, 24898, 14896, 472, 21975, 938, 412, 114, 154, 114, 38695, 28683, 20158, 48496, 938, 610, 114, 9499, 22611, 32690, 21109, 938, 468, 114, 44588, 716, 28254, 21076, 938, 410, 114, 710, 1337, 9621, 550, 49588, 391, 24765, 1159, 30944, 15971, 26905, 938, 438, 5193, 960, 40851, 46885, 938, 7482, 4597, 29775, 2584, 190, 383, 47580, 938, 40681, 2372, 29775, 13917, 2409, 6770, 669, 23231, 934, 12522, 7396, 633, 1867, 24759, 1159, 3309, 39633, 418, 114, 637, 42458, 19871, 1973, 938, 472, 114, 3087, 21171, 938, 451, 114, 152, 114, 20804, 37650, 938, 6062, 797, 6649, 11065, 22362, 2286, 13260, 938, 25961, 438, 42789, 26025, 938, 451, 114, 151, 114, 500, 9560, 27893, 19871, 1973, 938, 610, 114, 133, 114, 27570, 4728, 48913, 16682, 34275, 1159, 11921, 424, 562, 21232, 41259, 10419, 31754, 479, 938, 1810, 3027, 182, 1329, 11114, 3302, 938, 503, 505, 1235, 37619, 2717, 16150, 33809, 716, 954, 21109, 938, 7532, 10419, 44589, 938, 12655, 16446, 29677, 550, 492, 938, 472, 24512, 716, 30416, 34470, 16150, 33809, 716, 954, 21109, 938, 21232, 41259, 412, 114, 550, 1329, 2339, 46298, 38636, 1159, 8629, 43050, 43055, 503, 33168, 7386, 37171, 8427, 938, 550, 15253, 2825, 18620, 383, 468, 44303, 938, 1804, 481, 28882, 383, 670, 443, 2041, 393, 410, 43674, 21171, 938, 710, 8184, 21384, 383, 46721, 650, 44589, 18482, 938, 3510, 2041, 393, 507, 998, 177, 24597, 22182, 7668, 28222, 14914, 1159, 670, 114, 152, 114, 27849, 21217, 11595, 49674, 938, 468, 21194, 383, 19514, 33666, 938, 6967, 27556, 14504, 174, 5404, 387, 48989, 28562, 938, 22062, 43050, 14504, 7386, 938, 13409, 448, 18209, 434, 938, 6770, 17288, 4073, 36784, 670, 11062, 938, 503, 583, 478, 36784, 1182, 4271, 938, 7532, 455, 16019, 572, 15737, 12215, 11830, 938, 8629, 43050, 10985, 3200, 37171, 8427, 938, 12449, 518, 14504, 938, 550, 42284, 3302, 670, 189, 393, 451, 7347, 6182, 391, 3788, 33429, 1930, 4580, 1159, 23176, 45152, 14504, 938, 412, 49680, 14504, 938, 16682, 464, 43050, 9918, 49019, 1930, 1159, 11921, 11830, 38685, 5589, 448, 975, 7738, 21171, 670, 1799, 4073, 938, 448, 114, 146, 114, 8353, 28442, 36647, 938, 27132, 23261, 44589, 461, 660, 15561, 960, 448, 11754, 938, 29481, 37121, 1329, 13697, 23032, 37171, 8427, 938, 503, 505, 2041, 393, 418, 114, 3036, 1973, 938, 451, 3402, 21384, 383, 410, 43674, 6472, 383, 12208, 44120, 938, 448, 114, 140, 114, 5412, 45194, 21171, 938, 7668, 34207, 21076, 16682, 41259, 21076, 610, 2279, 9970, 448, 114, 146, 461, 9560, 1572, 13909, 1930, 1159, 36784, 438, 22537, 451, 7347, 938, 500, 114, 438, 24512, 4271, 472, 660, 938, 13409, 22774, 5868, 938, 10419, 37086, 425, 9970, 29634, 938, 10706, 35086, 781, 501, 444, 14237, 45157, 5795, 7619, 17487, 1930, 1159, 472, 114, 144, 114, 6770, 18910, 21109, 938, 30620, 8974, 3137, 22537, 18484, 44303, 938, 26983, 8948, 425, 7003, 1973, 1679, 7619, 17487, 1930, 1159, 448, 114, 140, 114, 44311, 19931, 938, 38695, 14504, 4728, 8948, 1930, 1159, 670, 114, 472, 1790, 9621, 938, 7532, 562, 37619, 2717, 472, 16585, 48496, 670, 622, 48913, 26046, 1159, 418, 20407, 5170, 21228, 44436, 14504, 938, 28058, 11211, 32708, 1012, 2825, 5132, 938, 7532, 10419, 44589, 410, 14347, 2844, 938, 20392, 478, 383, 7386, 461, 28130, 13841, 1867, 5475, 1456, 9970, 1159, 11079, 6860, 14504, 610, 114, 6770, 1057, 36700, 2844, 18484, 5431, 391, 438, 3317, 14326, 1159, 23938, 6693, 14967, 21171, 2063, 3200, 16682, 33168, 1159, 36784, 14504, 610, 7241, 1159, 448, 26716, 3317, 1044, 29842, 610, 38501, 7386, 468, 8184, 38110, 26046, 1159, 676, 1178, 43050, 14504, 2648, 3977, 12789, 609, 1669, 25619, 807, 18499, 458, 4471, 1368, 3788, 28731, 1159, 26905, 536, 31657, 803, 938, 40681, 2372, 4371, 31399, 26905, 1389, 448, 30289, 9120, 938, 23648, 9499, 13703, 938, 23648, 11712, 43717, 11457, 938, 29775, 9185, 960, 11457, 938, 418, 114, 9499, 13703, 938, 7679, 629, 44109, 24253, 938, 15971, 19755, 672, 38766, 448, 37426, 938, 7030, 468, 2844, 448, 11062, 938, 13409, 26206, 710, 38105, 8178, 938, 412, 2543, 46396, 710, 45908, 15737, 12215, 11830, 938, 23648, 438, 10781, 49729, 35086, 661, 938, 438, 3426, 7157, 472, 7157, 41800, 35086, 664, 938, 9499, 13703, 478, 468, 30289, 38033, 35086, 1702, 938, 418, 14737, 424, 26206, 29634, 938, 20630, 444, 48387, 32708, 461, 25115, 938, 16682, 1030, 48387, 26206, 461, 25115, 938, 12220, 27023, 11457, 938, 18451, 48375, 478, 11357, 181, 938, 18451, 48375, 434, 46712, 938, 12073, 424, 393, 44109, 451, 6797, 938, 47580, 489, 19514, 12624, 412, 7557, 1932, 39225, 32941, 960, 38766, 938, 7556, 36230, 366, 12205, 11457, 938, 438, 1979, 629, 44109, 24253, 938, 8983, 41751, 47778, 938, 550, 12748, 48387, 46396, 12491, 489, 27556, 938, 418, 114, 145, 114, 31846, 938, 8537, 10467, 46396, 41816, 938, 550, 620, 48387, 32708, 41816, 938, 19874, 12205, 938, 610, 36700, 27893, 12920, 421, 44109, 938, 438, 114, 133, 114, 134, 114, 144, 114, 49382, 21258, 938, 49382, 478, 39970, 938, 24404, 20360, 30289, 47778, 1296, 596, 44120, 938, 20973, 20630, 27971, 2734, 438, 114, 133, 114, 134, 114, 144, 114, 9918, 938, 438, 31431, 448, 43674, 5170, 710, 5383, 938, 448, 114, 144, 114, 3031, 1329, 478, 3550, 938, 40681, 2372, 1012, 6586, 444, 24253, 541, 5897, 3317, 938, 1012, 12337, 11211, 25295, 610, 36700, 27893, 938, 468, 114, 151, 114, 412, 7557, 1932, 39225, 938, 2214, 48387, 26206, 4299, 938, 11653, 629, 44109, 11457, 938, 610, 23469, 9004, 17438, 5868, 461, 25115, 938, 503, 13516, 2644, 19874, 2789, 33429, 1159, 438, 767, 8353, 16863, 1132, 29775, 11457, 461, 1822, 2372, 938, 503, 16585, 412, 19274, 938, 44311, 16471, 38766, 11457, 938, 415, 802, 1235, 9970, 47778, 11457, 938, 438, 767, 15971, 415, 802, 1235, 9970, 44109, 938, 15971, 12205, 17398, 41010, 938, 30944, 34957, 6860, 12205, 938, 12920, 444, 24253, 11457, 938, 6967, 27556, 17971, 434, 28660, 500, 47330, 938, 12981, 8691, 11457, 41136, 938, 25081, 9176, 366, 31846, 938, 18482, 41280, 1132, 47580, 489, 550, 19311, 30675, 938, 6967, 27556, 1012, 660, 41927, 6808, 366, 11457, 938, 20673, 23382, 22884, 1159, 11457, 23648, 503, 3200, 16471, 11457, 938, 11457, 6967, 27556, 9100, 18209, 434, 11457, 938, 6967, 27556, 1182, 425, 572, 22835, 2466, 11457, 10985, 35086, 1159, 17971, 486, 7132, 18971, 17971, 434, 46712, 938, 1079, 3200, 41199, 15971, 7976, 38501, 21448, 1183, 938, 438, 114, 133, 114, 5412, 7557, 406, 8629, 5475, 4204, 1159, 412, 114, 134, 114, 41280, 498, 29775, 11457, 5403, 570, 35243, 13018, 458, 4471, 1368, 40964, 1094, 7164, 383, 44571, 723, 391, 685, 1967, 2364, 14096, 1242, 363, 15997, 6347, 387, 363, 4858, 34373, 399, 10107, 387, 3895, 2815, 420, 1579, 391, 1416, 3033, 21810, 865, 1684, 114, 9100, 12194, 1094, 1866, 1804, 3178, 21171, 12888, 938, 461, 32289, 990, 4707, 387, 363, 4043, 8066, 452, 685, 1967, 420, 2548, 114, 2909, 938, 21810, 865, 1684, 114, 9100, 12194, 1094, 1866, 1804, 3178, 21171, 938, 9001, 387, 363, 461, 32289, 990, 4707, 938, 17829, 363, 2558, 4639, 387, 363, 4043, 8066, 385, 1684, 114, 13409, 48387, 451, 8948, 425, 420, 1780, 3490, 938, 25078, 865, 448, 114, 150, 114, 1804, 3178, 21171, 388, 4858, 34373, 399, 10107, 387, 3895, 865, 40964, 1094, 7164, 383, 44571, 723, 13694, 363, 39485, 10575, 388, 22818, 865, 31559, 458, 4471, 1368, 16004, 611, 10664, 438, 114, 507, 4831, 24041, 1235, 29414, 938, 4043, 2266, 515, 430, 7612, 6269, 36010, 7453, 938, 614, 4473, 1326, 114, 938, 458, 1069, 12618, 1159, 50064, 11231, 1932, 3428, 7969, 15449, 15403, 938, 2914, 1368, 938, 380, 114, 463, 114, 119, 16004, 611, 10664, 7660, 5680, 1673, 4967, 10249, 865, 5680, 1673, 523, 363, 2757, 420, 1468, 1838, 2914, 865, 43125, 2047, 633, 8971, 633, 1206, 865, 9530, 117, 386, 3014, 1159, 5680, 1673, 4967, 456, 3771, 458, 2893, 1368, 16004, 611, 10664, 448, 11594, 1094, 938, 507, 114, 145, 114, 458, 9869, 1368, 865, 507, 16145, 1151, 21109, 1615, 11736, 877, 48436, 450, 23114, 938, 382, 17441, 387, 12596, 3895, 865, 503, 4222, 23600, 2198, 865, 32530, 9874, 633, 23780, 633, 758, 26530, 633, 819, 865, 43125, 2312, 633, 1468, 633, 1697, 865, 7836, 3656, 458, 4471, 1368, 9634, 938, 17214, 4345, 865, 484, 4043, 8066, 938, 26313, 6541, 387, 358, 8842, 865, 1069, 12618, 1159, 321, 27856, 3895, 938, 7459, 865, 32530, 758, 633, 779, 633, 743, 33401, 3371, 633, 453, 865, 8537, 6940, 46396, 938, 438, 6159, 4813, 31610, 473, 34690, 391, 418, 5367, 4073, 31610, 473, 34690, 865, 3895, 4720, 20254, 1159, 31593, 5162, 865, 1069, 12618, 1159, 34525, 13762, 3895, 938, 3749, 865, 1153, 4043, 939, 633, 4572, 3296, 2269, 1026, 517, 13409, 4073, 17564, 3200, 3296, 1545, 7660, 28945, 12962, 41574, 1666, 10249, 3518, 388, 3804, 804, 363, 4043, 8066, 474, 1026, 865, 4043, 20254, 15578, 7544, 14150, 5713, 20240, 1563, 29174, 491, 15065, 6182, 11015, 28731, 3788, 3895, 5935, 3618, 13409, 4242, 3895, 21914, 3895, 5939, 387, 451, 22022, 4498, 5939, 387, 448, 2922, 384, 27626, 633, 438, 994, 483, 6277, 3375, 5599, 10568, 15793, 27626, 633, 1627, 31022, 6277, 3375, 5599, 10568, 12381, 4664, 6277, 17479, 31232, 8353, 44253, 3375, 27626, 633, 34730, 1911, 5599, 27626, 633, 34730, 1911, 412, 7838, 17154, 34949, 34949, 387, 1349, 3654, 5426, 33884, 7011, 618, 4644, 28314, 19481, 391, 35972, 1804, 3178, 21171, 1143, 23308, 35086, 1143, 16498, 24537, 4043, 24537, 5412, 10203, 17460, 15578, 3866, 24537, 388, 2621, 7330, 7132, 4073, 2265, 12337, 40508, 2552, 772, 44120, 3457, 412, 5868, 1329, 18816, 391, 8751, 2243, 754, 387, 28731, 458, 37267, 1368, 2243, 754, 387, 28731, 458, 21810, 1368, 9404, 3267, 4229, 7662, 3697, 12618, 633, 30794, 483, 38887, 484, 4043, 3446, 31700, 12652, 8353, 44253, 16498, 1478, 2780, 38887, 29361, 19274, 7132, 4073, 2265, 12337, 5412, 18183, 7132, 4073, 2265, 12337, 472, 4984, 1179, 4707, 472, 4984, 1179, 20310, 28750, 24761, 47617, 6182, 448, 10572, 19151, 1501, 11423, 7445, 23867, 8605, 113, 7323, 27285, 15578, 6887, 3697, 28215, 428, 2339, 14586, 633, 1456, 4664, 15578, 710, 35291, 710, 33931, 4620, 938, 36195, 31351, 10246, 10187, 1296, 13909, 610, 36700, 3317, 448, 34586, 19151, 19863, 7132, 4073, 2265, 12337, 25755, 11207, 35869, 1142, 42090, 44571, 723, 6459, 6776, 7922, 11146, 387, 17398, 41010, 9431, 2717, 412, 5868, 1329, 13855, 2906, 461, 3200, 8948, 2372, 7132, 4073, 2265, 12337, 670, 44327, 1193, 422, 2906, 428, 18046, 13086, 607, 711, 6009, 1702, 9614, 22182, 1478, 48571, 41561, 10586, 3185, 20094, 2292, 387, 30805, 418, 504, 35086, 29645, 4043, 15879, 428, 481, 41900, 12734, 48988, 3895, 49019, 8353, 44253, 43257, 389, 107, 266, 184, 366, 387, 676, 2372, 362, 1142, 4804, 1639, 5171, 387, 3895, 20254, 3697, 1837, 27893, 13415, 6182, 3457, 7322, 38290, 1540, 3895, 610, 9158, 42042, 1540, 633, 3895, 3866, 4142, 1153, 1631, 38340, 3510, 8947, 1044, 4073, 3510, 1329, 7679, 425, 17200, 11408, 4707, 503, 3200, 27556, 3716, 16498, 14293, 21874, 3516, 5497, 4043, 2452, 3263, 3895, 2198, 4043, 6096, 14431, 3457, 4043, 20254, 4142, 4043, 2452, 5508, 12686, 1131, 18971, 5412, 4831, 384, 410, 17332, 12703, 5412, 564, 1973, 610, 49776, 6860, 4664, 412, 5868, 1329, 3716, 618, 5584, 403, 1741, 11157, 418, 114, 670, 1799, 4222, 31022, 415, 9961, 13810, 4073, 670, 1973, 28475, 27556, 418, 22657, 1063, 7445, 448, 114, 150, 114, 1804, 3178, 21171, 448, 15599, 1804, 761, 8629, 19329, 425, 9970, 40523, 562, 461, 23032, 5383, 24900, 2133, 7347, 20630, 22412, 610, 5170, 716, 9476, 404, 503, 114, 1879, 16158, 45834, 415, 9961, 21448, 15813, 507, 4831, 24041, 22151, 27446, 2681, 42953, 503, 33168, 23308, 5170, 418, 4664, 21171, 503, 33168, 468, 2844, 461, 5170, 30401, 14737, 503, 505, 2041, 393, 1804, 7113, 24597, 3036, 1973, 24404, 5868, 46396, 670, 19426, 393, 32553, 550, 114, 134, 114, 13786, 8622, 3317, 550, 189, 414, 444, 5589, 1481, 2362, 50325, 2825, 10001, 670, 1554, 512, 14515, 28584, 438, 12337, 8060, 1615, 50273, 23176, 772, 6770, 5284, 2712, 22182, 438, 1172, 4813, 50234, 11733, 2398, 11090, 11114, 2534, 2372, 38850, 500, 21194, 31943, 2552, 6378, 16593, 5451, 7532, 498, 1973, 2549, 7846, 384, 513, 114, 154, 114, 472, 17586, 14915, 7532, 438, 22537, 9918, 472, 15354, 7718, 1973, 412, 12870, 12252, 12908, 412, 12337, 13982, 493, 24900, 2133, 7347, 8959, 371, 923, 1973, 1481, 2362, 1012, 12297, 26654, 500, 1673, 5451, 20973, 15513, 39055, 4699, 1733, 377, 24253, 11457, 17769, 28848, 397, 438, 2953, 15921, 11921, 424, 562, 461, 18912, 27556, 10419, 7886, 21171, 11921, 20082, 448, 14251, 18372, 11770, 7532, 7386, 11567, 3035, 29338, 27642, 5383, 20254, 8042, 418, 15166, 610, 45050, 7679, 425, 418, 13328, 21773, 2681, 4585, 418, 29759, 416, 3309, 1005, 7738, 418, 114, 143, 114, 18451, 48375, 478, 11357, 181, 1540, 10001, 412, 5451, 20159, 7668, 14497, 11836, 14326, 2717, 31793, 2372, 25961, 30938, 516, 7945, 170, 30289, 48073, 11457, 9100, 11211, 22774, 5868, 14504, 9100, 46191, 550, 10781, 9100, 18209, 434, 18482, 2974, 17567, 4453, 11457, 8629, 19329, 425, 9970, 40523, 562, 448, 15563, 26603, 14504, 47580, 489, 17165, 10467, 6770, 14302, 448, 3200, 41369, 14504, 33754, 877, 3856, 12908, 16682, 716, 498, 7638, 7738, 13857, 9636, 16682, 9333, 20871, 428, 1790, 16682, 1030, 48387, 26206, 461, 25115, 43585, 7738, 46396, 9918, 8537, 11736, 46396, 3276, 428, 114, 13409, 464, 33168, 431, 49674, 46396, 1012, 1089, 9970, 7679, 425, 428, 3303, 960, 550, 366, 716, 710, 816, 19274, 13982, 29634, 17516, 498, 44589, 11114, 374, 31471, 461, 23032, 5383, 24900, 2133, 7347, 461, 7738, 14504, 10444, 28848, 642, 7347, 500, 597, 2133, 3402, 48496, 503, 33168, 38695, 1615, 14737, 1101, 1615, 50273, 448, 30416, 34470, 11528, 2214, 3697, 383, 780, 30401, 12713, 3317, 655, 424, 366, 38766, 11457, 30971, 481, 40704, 550, 7347, 24732, 438, 22537, 412, 13662, 32384, 550, 7347, 24732, 32708, 29634, 40964, 1094, 7164, 383, 44571, 723, 610, 114, 610, 39337, 1329, 610, 2372, 7846, 383, 383, 42837, 41683, 383, 12208, 44120, 11457, 23648, 12073, 1979, 16471, 11457, 5412, 48029, 960, 448, 678, 1012, 481, 38695, 14504, 507, 6182, 507, 1329, 8172, 43055, 438, 114, 448, 3200, 21942, 716, 1482, 45050, 438, 114, 146, 114, 9918, 6770, 18209, 26537, 11567, 3035, 6770, 5284, 2712, 22182, 1970, 13629, 16593, 3060, 7482, 1296, 165, 14424, 44238, 44737, 4868, 371, 321, 100, 15971, 12205, 550, 660, 9970, 15971, 12205, 17398, 41010, 15971, 438, 767, 18681, 2776, 28139, 2844, 500, 4761, 877, 500, 1973, 46366, 9290, 500, 2372, 18451, 32757, 23502, 500, 2372, 10419, 3246, 451, 114, 31351, 27642, 451, 32289, 48073, 710, 8283, 4490, 47264, 1146, 471, 2961, 44327, 4490, 47264, 1146, 471, 2961, 44327, 11735, 37458, 1353, 422, 29634, 410, 5164, 472, 114, 10033, 175, 9560, 10647, 48644, 412, 1063, 10239, 23032, 13409, 48387, 451, 8948, 425, 7532, 451, 8948, 425, 38146, 25534, 472, 3317, 507, 4831, 24041, 672, 1973, 27721, 1456, 49674, 448, 678, 412, 12337, 13982, 493, 24900, 2133, 7347, 412, 14309, 15617, 7861, 7798, 6967, 13311, 5463, 500, 1973, 747, 7132, 4073, 18697, 461, 749, 32445, 6693, 633, 321, 564, 633, 9738, 4813, 36939, 422, 7386, 38695, 670, 11062, 15739, 36005, 5284, 38766, 18482, 27721, 19931, 7462, 1329, 321, 564, 633, 461, 660, 9372, 3935, 10235, 46396, 448, 678, 1879, 16158, 45834, 33754, 7347, 1879, 1772, 10647, 21109, 412, 12252, 4299, 4073, 2412, 1733, 1790, 451, 8948, 425, 31610, 473, 34690, 37824, 472, 3317, 412, 15205, 560, 4271, 410, 30548, 32708, 29634, 29171, 4073, 410, 3109, 17054, 12719, 14326, 19263, 19274, 12122, 1973, 24070, 44931, 5404, 30679, 21481, 11144, 498, 41259, 670, 114, 143, 114, 38695, 2286, 13260, 670, 30416, 34470, 166, 44589, 33211, 6757, 24759, 6797, 670, 1554, 2697, 3926, 27556, 14515, 28584, 11921, 424, 562, 461, 18912, 27556, 10419, 7886, 21171, 16150, 11021, 2697, 877, 710, 45908, 15737, 12215, 11830, 676, 1178, 8250, 2314, 5589, 6580, 21171, 31705, 48387, 1012, 2825, 5132, 618, 3618, 2867, 15430, 29434, 1781, 869, 11525, 16884, 28100, 48571, 11526, 1008, 3942, 4525, 26462, 29597, 362, 438, 20525, 12449, 15811, 44625, 448, 31472, 795, 5729, 166, 41870, 3995, 49149, 507, 20861, 1223, 47823, 3907, 960, 428, 481, 41900, 7556, 21384, 443, 21276, 38431, 20254, 20485, 12734, 47137, 442, 387, 4242, 20949, 388, 3895, 8066, 2167, 387, 3895, 4043, 41430, 387, 503, 12263, 4043, 20254, 2292, 2243, 754, 387, 3895, 14712, 11913, 3285, 5132, 8886, 12389, 6792, 387, 3895, 3618, 13409, 4382, 387, 3895, 11874, 30457, 4382, 4382, 387, 1913, 5795, 30457, 10107, 15941, 387, 1837, 17487, 4858, 34373, 399, 10107, 387, 3895, 20946, 425, 13409, 4073, 42042, 36962, 42042, 39066, 7738, 42042, 944, 45157, 26046, 1044, 9714, 38110, 26046, 1182, 37788, 45402, 710, 5284, 48111, 5009, 17280, 2452, 9848, 25320, 387, 12618, 503, 12263, 30412, 468, 661, 2372, 468, 8184, 38110, 26046, 550, 49588, 391, 24765, 550, 172, 769, 5094, 31726, 48189, 34750, 4728, 48913, 26046, 41725, 438, 3317, 14326, 8437, 14302, 11830, 438, 41383, 960, 500, 8227, 1145, 10630, 19489, 11735, 6178, 13473, 33429, 7668, 28222, 14914, 412, 36174, 421, 32620, 47018, 1766, 17305, 2372, 18484, 5431, 44845, 26046, 36158, 30548, 5094, 2789, 28731, 39066, 7738, 6443, 18209, 944, 45157, 26046, 45402, 550, 49588, 391, 24765, 31726, 48189, 41725, 1766, 17305, 2372, 44845, 26046, 43125, 523, 7660, 3841, 1479, 369, 114, 31367, 114, 2499, 115, 187, 115, 9731, 114, 10222, 131, 7940, 129, 34285, 34373, 399, 163, 49771, 163, 1760, 163, 21670, 106, 450, 20940, 129, 42341, 29908, 24470, 10249, 45587, 1159, 26841, 2207, 387, 3895, 5795, 30457, 10107, 387, 3895, 14712, 2207, 387, 3895, 4858, 34373, 399, 10107, 387, 3895, 20559, 9477, 1159, 9530, 117, 386, 3014, 1159, 5680, 1673, 4967, 456, 3771, 22799, 18240, 3325, 10389, 523, 2906, 2422, 1540, 6786, 18240, 3325, 10389, 5866, 4043, 3695, 523, 3368, 2312, 1540, 15413, 6786, 3295, 388, 4043, 3695, 5866, 389, 1921, 9768, 523, 2794, 2312, 1540, 6786, 452, 5677, 30656, 6400, 22799, 452, 5677, 30656, 6400, 523, 2794, 2047, 12268, 26815, 8095, 15413, 12424, 264, 15253, 321, 100, 13182, 15563, 16357, 33958, 10216, 321, 100, 321, 100, 321, 100, 321, 100, 5413, 6218, 871, 2544, 474, 1039, 13113, 420, 2909, 3368, 2965, 938, 480, 939, 1159, 3540, 458, 18220, 1368, 865, 8356, 419, 1796, 840, 363, 17505, 13916, 45437, 633, 8835, 133, 2440, 13890, 2263, 3325, 2947, 844, 4275, 865, 2851, 1363, 529, 2625, 938, 446, 4337, 385, 363, 17738, 387, 5866, 391, 16878, 7921, 865, 15413, 321, 207, 419, 358, 6924, 16129, 387, 363, 44978, 5794, 938, 3558, 114, 938, 358, 1830, 113, 9284, 4110, 865, 8095, 15413, 66], "start_token": -100, "end_token": -100, "category": 0}
|
{"input_ids": [65, 609, 6250, 363, 575, 2775, 2872, 1469, 420, 43937, 25552, 66, 8408, 420, 18583, 21247, 633, 321, 31367, 8408, 420, 18583, 21247, 22920, 17641, 1159, 2411, 321, 209, 2635, 321, 100, 500, 23414, 321, 209, 7733, 321, 100, 471, 321, 100, 1321, 321, 100, 2411, 114, 27925, 321, 209, 500, 23414, 114, 31128, 321, 209, 471, 321, 100, 1321, 2411, 114, 27925, 2263, 633, 23414, 114, 31128, 8408, 420, 18583, 21247, 2243, 387, 363, 7330, 391, 363, 8312, 22308, 387, 2260, 1911, 2974, 19004, 387, 5939, 6821, 11415, 2178, 523, 358, 5061, 6715, 480, 363, 3827, 387, 363, 1469, 865, 484, 11379, 388, 363, 3742, 419, 358, 39124, 5688, 420, 23217, 2789, 6126, 865, 5031, 9375, 5061, 13117, 561, 408, 1876, 1159, 631, 726, 23217, 3270, 519, 8974, 391, 631, 726, 363, 20919, 30923, 865, 7637, 3527, 868, 938, 23335, 2263, 8785, 913, 2185, 458, 23335, 633, 1206, 633, 8854, 1368, 13498, 11561, 3194, 18583, 21247, 938, 13809, 25320, 938, 572, 114, 151, 114, 25515, 8487, 5061, 16207, 5474, 2263, 18913, 14040, 363, 10485, 387, 363, 1679, 1930, 757, 2260, 1911, 2974, 4192, 7049, 387, 363, 1469, 420, 18583, 21247, 7560, 8355, 759, 1679, 1930, 2970, 1621, 45171, 391, 2867, 418, 23228, 13996, 4004, 513, 114, 46653, 507, 36091, 15920, 10174, 13854, 23228, 710, 100, 16691, 15297, 43813, 418, 23228, 1249, 374, 11702, 14164, 25485, 428, 7808, 22525, 20996, 477, 895, 3856, 14747, 908, 3445, 26414, 908, 4731, 21673, 1643, 11512, 21301, 705, 34132, 614, 1395, 39917, 428, 47074, 6399, 685, 8038, 321, 100, 33983, 6316, 12274, 11902, 1159, 819, 6316, 16752, 463, 3445, 26414, 463, 4435, 4731, 21673, 453, 1758, 35340, 961, 11512, 21301, 908, 25807, 16050, 2343, 11127, 34132, 743, 386, 17585, 34132, 46001, 6316, 428, 27446, 10456, 391, 9190, 705, 3445, 26414, 24891, 705, 3445, 26414, 9795, 453, 510, 113, 38572, 6821, 24891, 453, 25552, 27863, 24891, 614, 4731, 21673, 9795, 614, 11512, 21301, 9795, 614, 685, 8038, 9795, 27879, 6316, 6673, 26523, 6316, 9795, 463, 112, 27427, 3024, 453, 112, 21240, 10758, 705, 386, 17585, 34132, 24891, 453, 386, 17585, 25028, 22905, 2909, 6316, 6673, 9016, 6316, 9795, 5699, 3024, 453, 43373, 8008, 48010, 35925, 18600, 8358, 3024, 3540, 10758, 614, 6316, 2924, 967, 29928, 12111, 13819, 18583, 21247, 11657, 4550, 660, 453, 402, 7316, 1115, 29073, 391, 3276, 49317, 463, 459, 7316, 1115, 614, 4473, 7316, 1115, 5061, 673, 742, 1184, 938, 16337, 1478, 22559, 4242, 1524, 5475, 1538, 17053, 4535, 11830, 448, 8654, 179, 18583, 21247, 9865, 9172, 13417, 39383, 20542, 11015, 3788, 42657, 1069, 22878, 12652, 40407, 4606, 4043, 10793, 20385, 11668, 41491, 6997, 2359, 2354, 8312, 1911, 5795, 8312, 13809, 9887, 5792, 633, 10790, 628, 1013, 20472, 461, 2339, 31730, 12549, 41491, 6997, 7316, 1115, 321, 18377, 20385, 11668, 10790, 628, 1013, 1323, 9887, 5792, 29524, 16092, 1323, 3276, 660, 48481, 1323, 11190, 2825, 24868, 934, 2825, 21300, 7330, 1524, 5475, 1538, 458, 16337, 1368, 4043, 10793, 458, 16337, 1478, 4254, 1368, 13417, 23335, 1478, 5534, 22299, 633, 19034, 1911, 17053, 11015, 3788, 42657, 4535, 11830, 9865, 9172, 12652, 1524, 5475, 1538, 458, 15862, 1368, 4535, 43653, 41508, 12686, 1686, 31206, 16841, 1269, 14811, 25100, 13572, 458, 17095, 1478, 4254, 1368, 40407, 40407, 458, 23335, 1478, 5534, 1368, 40407, 458, 22559, 1478, 6047, 1368, 40407, 458, 17095, 1368, 40407, 458, 17095, 1478, 4254, 1368, 24421, 8312, 11015, 3788, 42657, 23335, 1478, 5534, 21914, 17054, 4592, 4606, 1069, 22878, 13417, 17095, 1478, 4254, 448, 8654, 179, 15862, 2359, 2354, 7223, 3923, 9401, 416, 767, 12111, 513, 4270, 10539, 6353, 507, 32404, 6502, 20120, 6904, 549, 3802, 7668, 2441, 3865, 21291, 5036, 468, 4813, 451, 156, 2970, 3802, 20472, 1627, 7585, 12111, 48481, 1323, 11190, 2825, 24868, 1249, 11891, 3008, 10574, 20919, 35386, 1003, 25556, 46251, 14953, 25706, 6378, 4797, 610, 596, 5689, 7308, 43023, 1323, 15297, 33947, 12655, 41509, 11712, 32289, 9491, 5061, 17009, 438, 3803, 34585, 29677, 11702, 369, 438, 3803, 34585, 458, 15862, 1368, 13960, 3803, 15584, 412, 11423, 14515, 5552, 12655, 22480, 12111, 1012, 5801, 13516, 5599, 412, 2980, 633, 5061, 1911, 484, 1469, 420, 18583, 21247, 474, 358, 6076, 2523, 5688, 517, 363, 11874, 5061, 8666, 3802, 4910, 1129, 363, 1679, 1930, 19115, 2880, 480, 18583, 21247, 938, 13809, 25320, 938, 420, 363, 3430, 387, 3527, 868, 938, 23335, 865, 484, 1469, 938, 736, 2001, 456, 363, 5939, 387, 18583, 21247, 938, 3058, 385, 363, 1679, 1930, 806, 5827, 757, 2260, 1911, 2974, 865, 484, 5061, 2523, 5632, 6513, 385, 363, 1469, 456, 363, 13809, 14781, 391, 14781, 9653, 938, 391, 456, 14781, 1269, 1242, 764, 5511, 865, 2970, 5393, 363, 1469, 456, 358, 37298, 2324, 385, 1495, 363, 572, 114, 151, 114, 8312, 20102, 523, 32975, 452, 764, 6128, 2523, 4129, 388, 21300, 7330, 1129, 11393, 16872, 387, 363, 1679, 7627, 938, 363, 12772, 938, 391, 363, 1679, 1930, 865, 3928, 363, 1882, 387, 3699, 2351, 713, 648, 22181, 5061, 3535, 420, 363, 572, 114, 151, 114, 633, 2815, 13417, 938, 39383, 391, 20542, 5552, 391, 420, 363, 3618, 8166, 388, 4535, 11830, 938, 12652, 938, 391, 9865, 9172, 865, 484, 1469, 32501, 480, 868, 1159, 4865, 358, 114, 177, 114, 29928, 3963, 458, 1349, 1159, 1349, 17088, 1368, 865, 484, 2880, 474, 7485, 517, 47668, 11874, 5061, 6316, 458, 1491, 8587, 938, 1342, 391, 15748, 26228, 938, 391, 39124, 26228, 1368, 388, 835, 9914, 938, 5712, 523, 2338, 6316, 16752, 865, 1540, 3725, 572, 114, 151, 114, 8666, 3445, 26414, 648, 9795, 938, 452, 1541, 24891, 865, 1540, 576, 363, 23217, 8044, 648, 1669, 4477, 938, 391, 2338, 648, 4605, 385, 2240, 391, 1917, 420, 385, 2008, 388, 363, 1276, 865, 484, 5061, 736, 30996, 494, 9795, 1216, 4731, 21673, 938, 1216, 11512, 21301, 938, 382, 3199, 113, 165, 27103, 3148, 4175, 938, 391, 631, 6265, 29390, 865, 1982, 3571, 37617, 633, 3725, 572, 114, 151, 114, 6316, 648, 6673, 2263, 463, 112, 31653, 3500, 648, 3024, 391, 453, 112, 23289, 1955, 648, 10758, 865, 28612, 2880, 26263, 985, 456, 363, 1277, 4530, 938, 5995, 23524, 938, 4175, 9514, 938, 9363, 938, 391, 5353, 391, 39124, 6244, 7392, 938, 456, 981, 456, 363, 25028, 380, 3284, 391, 10144, 2716, 458, 736, 1464, 387, 363, 4531, 2766, 1368, 938, 648, 508, 7485, 865, 5061, 9190, 648, 1758, 1159, 2909, 6316, 391, 2037, 386, 17585, 34132, 2727, 938, 391, 5699, 37857, 9053, 3024, 865, 1982, 5061, 43373, 938, 16486, 20996, 13332, 422, 8283, 938, 474, 8008, 865, 484, 6076, 1469, 1726, 456, 358, 12083, 6481, 385, 363, 1706, 762, 391, 3058, 3365, 385, 363, 1706, 5827, 757, 2260, 1911, 2974, 388, 1212, 363, 8312, 391, 3528, 20651, 865, 484, 1809, 1211, 938, 3527, 908, 938, 363, 1679, 1930, 6976, 1276, 420, 2970, 938, 391, 1912, 1629, 1669, 938, 420, 3527, 1468, 938, 4587, 391, 8132, 1224, 6976, 1276, 420, 363, 572, 114, 151, 114, 484, 572, 114, 151, 114, 7183, 452, 358, 14406, 387, 1276, 1129, 4587, 391, 8132, 865, 29116, 1205, 430, 1830, 113, 3950, 4119, 1143, 938, 644, 651, 688, 31566, 1302, 363, 7319, 387, 4982, 388, 16337, 938, 12221, 865, 1419, 648, 6510, 6855, 8656, 759, 430, 656, 43600, 2523, 2324, 517, 2970, 938, 576, 363, 3193, 387, 698, 8867, 6610, 938, 3674, 1082, 9926, 648, 1092, 5830, 7145, 938, 3058, 2093, 14122, 461, 114, 19398, 385, 24031, 3527, 868, 938, 23335, 938, 7660, 358, 3229, 644, 582, 2208, 388, 1268, 14915, 10249, 865, 4463, 363, 1469, 3123, 1332, 358, 14406, 387, 1276, 391, 1332, 8053, 6610, 938, 363, 1469, 420, 18583, 21247, 474, 1669, 19690, 388, 363, 11891, 29046, 385, 408, 358, 1276, 4166, 865, 26815, 453, 25454, 385, 5459, 453, 114, 117, 461, 24806, 13831, 4570, 453, 114, 118, 12943, 5511, 453, 114, 119, 9616, 1184, 463, 38167, 391, 1469, 463, 114, 117, 3935, 3977, 1228, 463, 114, 118, 5061, 14406, 387, 1276, 463, 114, 119, 3375, 6870, 11843, 463, 114, 120, 5599, 6870, 11843, 463, 114, 121, 1706, 18600, 391, 2566, 463, 114, 122, 5061, 9190, 463, 114, 123, 33772, 2469, 6870, 614, 34945, 2727, 494, 9795, 614, 114, 117, 5939, 26414, 614, 114, 118, 1576, 113, 38572, 6821, 458, 2597, 1321, 16024, 3148, 4175, 1368, 614, 114, 119, 6573, 21673, 614, 114, 120, 461, 47793, 21301, 614, 114, 121, 47206, 447, 18462, 705, 20433, 597, 743, 2394, 11119, 743, 114, 117, 11657, 4550, 660, 32832, 743, 114, 118, 25100, 11040, 743, 114, 119, 29985, 49641, 4485, 420, 1706, 4531, 819, 655, 3069, 4069, 868, 4192, 736, 908, 31559, 961, 34680, 6218, 25454, 385, 5459, 8875, 2809, 1159, 18816, 3857, 385, 363, 1469, 420, 18583, 21247, 461, 24806, 13831, 4570, 1911, 1123, 2970, 391, 363, 1679, 1930, 651, 688, 358, 5986, 427, 1224, 3378, 651, 688, 4011, 387, 938, 391, 6128, 430, 938, 1302, 363, 14163, 183, 865, 2203, 938, 15834, 851, 508, 6512, 1764, 1667, 2970, 321, 439, 11897, 387, 438, 3803, 34585, 388, 34726, 865, 3928, 363, 1407, 5808, 938, 2970, 10003, 757, 2908, 938, 3857, 385, 363, 5599, 412, 2980, 633, 5061, 1911, 388, 28785, 865, 2970, 3478, 11192, 3727, 2212, 385, 28192, 2908, 938, 391, 15636, 48376, 385, 5814, 1677, 4896, 4234, 385, 18289, 5474, 420, 363, 22880, 865, 484, 7660, 8151, 14781, 10249, 474, 3663, 385, 3443, 878, 4141, 865, 18583, 21247, 420, 3368, 1643, 938, 23335, 938, 2146, 26384, 18063, 388, 3527, 28785, 938, 3096, 985, 456, 363, 5061, 1469, 420, 23217, 6062, 424, 938, 363, 33562, 4620, 938, 391, 363, 500, 15331, 40703, 28608, 4986, 1272, 4560, 19040, 1129, 2970, 865, 477, 6749, 5061, 7219, 938, 363, 1679, 1930, 938, 1679, 7627, 938, 391, 4982, 18520, 2908, 452, 764, 10122, 430, 1276, 5228, 8693, 865, 655, 16337, 938, 2970, 26567, 4242, 1524, 5475, 1538, 938, 9462, 385, 9045, 44972, 363, 5303, 387, 9517, 9079, 2908, 865, 484, 1679, 1930, 27872, 29412, 387, 32909, 938, 3455, 938, 4673, 5000, 938, 391, 22649, 21509, 385, 2970, 938, 644, 363, 6947, 11168, 456, 382, 656, 13221, 820, 865, 484, 1679, 1930, 851, 508, 2346, 3157, 15420, 938, 2259, 938, 11577, 881, 387, 363, 26703, 15699, 388, 2770, 1159, 1914, 5061, 21504, 420, 1706, 3157, 938, 985, 382, 2324, 474, 1985, 385, 408, 3278, 382, 3358, 41310, 865, 655, 3196, 113, 117, 47000, 938, 2093, 14122, 461, 114, 19398, 3989, 363, 8312, 20102, 523, 3087, 9601, 385, 13809, 865, 780, 736, 6250, 358, 2523, 40603, 388, 363, 13417, 938, 2364, 1212, 4129, 388, 363, 3012, 387, 48102, 5061, 15670, 388, 363, 6856, 3788, 865, 4463, 363, 5061, 1130, 3242, 474, 458, 33269, 1368, 1829, 698, 1469, 420, 363, 1679, 7627, 321, 439, 21300, 7841, 20949, 938, 1491, 12652, 938, 662, 2323, 363, 572, 114, 151, 114, 757, 363, 1276, 938, 358, 14202, 37298, 5688, 4221, 385, 408, 363, 792, 936, 385, 3049, 1706, 19115, 14618, 865, 1153, 11897, 387, 363, 13417, 474, 736, 3278, 3407, 517, 5061, 1276, 33697, 865, 484, 572, 114, 151, 114, 1911, 5325, 12043, 651, 32396, 11850, 363, 13417, 452, 382, 9186, 2801, 387, 2420, 112, 931, 1551, 2263, 529, 3139, 474, 1340, 9278, 2334, 385, 5572, 523, 15897, 46727, 938, 609, 3037, 440, 662, 862, 358, 2801, 3579, 1762, 427, 2647, 865, 2851, 23335, 938, 572, 114, 151, 114, 33697, 3039, 385, 6972, 363, 13417, 480, 363, 17746, 387, 1276, 865, 18420, 427, 715, 938, 24747, 5759, 428, 114, 11446, 938, 11662, 387, 363, 418, 13497, 1613, 20102, 938, 474, 1914, 6367, 385, 427, 1346, 865, 484, 572, 114, 151, 114, 3544, 24469, 3157, 15420, 385, 2970, 388, 3002, 23335, 938, 1809, 363, 22439, 387, 4242, 1524, 5475, 1538, 807, 363, 7319, 387, 4982, 938, 388, 737, 881, 387, 750, 1706, 8834, 420, 6029, 3157, 7428, 865, 4463, 387, 529, 2652, 938, 2970, 18915, 452, 3453, 385, 1112, 363, 3157, 633, 5628, 11015, 3788, 42657, 865, 1651, 3033, 1697, 938, 19398, 7829, 2970, 427, 2354, 474, 5698, 385, 1112, 12431, 4932, 712, 7660, 19752, 2779, 10249, 648, 7485, 865, 484, 5061, 648, 7553, 452, 358, 36739, 38486, 1478, 2136, 8500, 523, 2908, 391, 4526, 2087, 938, 494, 21132, 750, 4338, 387, 8347, 5797, 388, 363, 8372, 633, 5628, 3528, 20949, 387, 21300, 7330, 865, 2970, 391, 363, 572, 114, 151, 114, 8054, 388, 9926, 1242, 23335, 938, 9462, 385, 3088, 2417, 865, 655, 363, 1882, 387, 878, 9926, 938, 2970, 4539, 385, 8500, 523, 850, 387, 2908, 391, 1524, 5475, 1538, 807, 1743, 4268, 452, 363, 8842, 49946, 1331, 865, 733, 736, 5251, 385, 11307, 382, 4896, 10895, 387, 363, 7664, 4012, 679, 41561, 391, 385, 25234, 523, 3393, 8940, 938, 2911, 578, 685, 7128, 321, 29203, 1151, 10634, 865, 2770, 8707, 878, 11729, 865, 5061, 5638, 4240, 610, 30042, 6049, 889, 4539, 385, 1927, 452, 19398, 938, 576, 19398, 11290, 420, 9079, 382, 4482, 979, 698, 3350, 865, 484, 572, 114, 151, 114, 14892, 385, 2970, 7931, 11744, 19398, 385, 2554, 363, 3350, 938, 6610, 427, 441, 474, 363, 792, 936, 385, 12302, 363, 1774, 2504, 2971, 610, 30042, 6049, 1331, 391, 4268, 388, 363, 8312, 865, 2203, 938, 566, 15703, 474, 508, 13235, 2503, 865, 484, 610, 30042, 6049, 1331, 14808, 363, 1809, 1328, 938, 719, 363, 5061, 2523, 8707, 358, 15321, 387, 578, 6654, 523, 2908, 865, 2970, 321, 439, 2558, 7062, 938, 6894, 420, 3490, 1261, 938, 4539, 385, 8500, 523, 8473, 1524, 5475, 1538, 391, 385, 25234, 523, 3535, 388, 21300, 7330, 938, 624, 991, 456, 363, 1679, 1930, 938, 1679, 7627, 938, 391, 12772, 24469, 6234, 385, 2908, 391, 13764, 612, 9489, 1129, 2970, 865, 484, 1706, 3854, 113, 1777, 40108, 387, 3490, 2709, 458, 3490, 2782, 388, 2970, 1368, 938, 363, 28339, 3566, 938, 2773, 2970, 3291, 36417, 2908, 1332, 3504, 391, 13897, 1830, 113, 464, 32484, 380, 8757, 452, 8312, 5736, 865, 1651, 3490, 2709, 388, 2970, 938, 363, 1211, 979, 363, 3566, 321, 439, 7686, 938, 363, 5061, 4977, 2801, 1465, 2594, 430, 18583, 21247, 865, 12943, 5511, 28988, 38530, 5511, 430, 382, 1469, 420, 18583, 21247, 385, 1906, 363, 1546, 757, 363, 7660, 8151, 20958, 9599, 10249, 458, 363, 5061, 3482, 430, 363, 11015, 3788, 42657, 391, 21300, 7330, 4244, 1368, 651, 9359, 946, 2004, 388, 23335, 840, 363, 45163, 1164, 387, 24747, 1249, 374, 11702, 14164, 25485, 938, 889, 25872, 2970, 321, 439, 32129, 20102, 865, 780, 1940, 456, 34187, 385, 8867, 5511, 391, 3148, 430, 382, 1469, 523, 363, 11874, 5061, 8666, 3712, 10084, 792, 807, 982, 22728, 452, 20919, 32294, 938, 1491, 358, 2473, 385, 11032, 566, 3242, 865, 6563, 633, 5147, 5511, 474, 17816, 517, 2004, 6177, 23335, 938, 7626, 517, 30245, 24747, 11190, 100, 178, 46015, 49421, 8231, 938, 452, 6930, 523, 8700, 1956, 27887, 503, 7539, 391, 14164, 25485, 321, 439, 15211, 6054, 387, 10084, 938, 8700, 12771, 27307, 18233, 3869, 8184, 865, 484, 33697, 9814, 363, 16337, 3618, 1734, 1469, 420, 363, 8301, 11127, 480, 14211, 14824, 17610, 2381, 865, 3928, 363, 1407, 1912, 2034, 938, 15083, 648, 8877, 938, 5213, 474, 16674, 938, 391, 4531, 474, 7824, 865, 8046, 878, 21619, 938, 10952, 29480, 1320, 10195, 851, 508, 14863, 363, 1469, 1511, 1667, 3490, 743, 938, 807, 363, 2469, 387, 1541, 11874, 7427, 5073, 1545, 385, 2175, 363, 2401, 865, 8226, 19702, 474, 508, 1914, 517, 363, 23230, 1667, 3527, 453, 938, 807, 358, 3842, 387, 5061, 2867, 13131, 784, 363, 7660, 28339, 5841, 10249, 662, 7660, 4218, 363, 16022, 387, 363, 2908, 4620, 938, 35377, 1970, 46120, 20996, 391, 16738, 5061, 1731, 387, 5070, 865, 10249, 2851, 2840, 23335, 938, 968, 18085, 4863, 427, 39183, 1123, 363, 572, 114, 151, 114, 391, 2970, 648, 21262, 865, 418, 29284, 3379, 756, 979, 363, 1469, 420, 18583, 21247, 1144, 427, 6841, 4165, 387, 3500, 3039, 1276, 452, 2970, 938, 2782, 4165, 851, 508, 938, 391, 2411, 4165, 651, 746, 4560, 865, 2994, 572, 114, 151, 114, 8312, 12637, 391, 7392, 651, 688, 4725, 420, 8096, 420, 968, 12533, 938, 572, 114, 151, 114, 2929, 37205, 18583, 21247, 662, 408, 363, 818, 2597, 2263, 2528, 938, 585, 3039, 363, 13417, 662, 408, 7485, 818, 865, 871, 35568, 474, 2334, 385, 363, 2473, 427, 363, 1734, 12637, 3791, 363, 1600, 391, 363, 19115, 2880, 480, 31822, 15560, 385, 5518, 15397, 938, 456, 981, 456, 385, 363, 28753, 387, 9517, 385, 2970, 523, 7775, 385, 363, 5467, 865, 1220, 736, 23276, 4863, 427, 2970, 474, 508, 6108, 387, 17361, 618, 722, 631, 1789, 19115, 5006, 480, 358, 741, 865, 9616, 1184, 484, 5061, 1469, 651, 1912, 1789, 12132, 865, 3375, 938, 441, 5393, 385, 4218, 1694, 1706, 11127, 5092, 938, 12940, 12275, 363, 8312, 20102, 523, 32975, 452, 5061, 29280, 387, 363, 11015, 3788, 42657, 391, 4535, 11830, 391, 385, 7240, 2970, 385, 23976, 21300, 7330, 1332, 14618, 865, 5599, 938, 441, 474, 10820, 385, 2923, 741, 430, 2970, 385, 38663, 764, 2393, 391, 2721, 764, 19115, 4303, 979, 4175, 16995, 10536, 517, 363, 16337, 670, 8000, 633, 24205, 2292, 33689, 698, 2964, 387, 5474, 865, 10568, 938, 385, 5304, 358, 6712, 385, 2354, 321, 439, 2795, 385, 43595, 764, 3487, 388, 363, 8312, 938, 3445, 26414, 648, 7248, 456, 363, 1489, 6771, 938, 1302, 585, 648, 363, 29164, 8038, 387, 698, 24057, 480, 363, 741, 865, 9562, 938, 441, 474, 10820, 427, 363, 1469, 662, 16738, 1706, 29752, 985, 427, 363, 572, 114, 151, 114, 1331, 662, 4369, 764, 8766, 10489, 385, 5061, 5454, 938, 391, 662, 5481, 358, 13211, 4268, 452, 2970, 865, 4386, 14233, 363, 8312, 20102, 480, 18122, 388, 18583, 21247, 5382, 835, 7411, 38558, 1159, 363, 8078, 8038, 662, 408, 388, 946, 19438, 1761, 938, 624, 441, 662, 408, 5466, 2663, 385, 32605, 391, 5558, 9286, 707, 2263, 391, 850, 387, 363, 19037, 662, 7967, 363, 1469, 938, 1302, 968, 662, 408, 420, 15292, 2767, 494, 662, 408, 19969, 523, 363, 25552, 865, 418, 2353, 1694, 21508, 1478, 529, 387, 10677, 938, 391, 2001, 385, 363, 5061, 1478, 474, 363, 8990, 523, 18583, 21247, 387, 578, 1216, 387, 363, 572, 114, 151, 114, 8312, 20102, 321, 439, 6316, 16752, 458, 15074, 938, 39641, 938, 391, 412, 34275, 11050, 1368, 865, 321, 23953, 146, 1454, 3242, 474, 7324, 385, 24747, 438, 19311, 321, 439, 7660, 21213, 3445, 10249, 13216, 938, 2693, 427, 387, 13998, 363, 5516, 1372, 387, 3445, 26414, 865, 8046, 878, 4887, 938, 14164, 25485, 3167, 385, 1904, 4159, 865, 5061, 6729, 388, 612, 2795, 385, 4721, 358, 1891, 938, 32057, 1276, 736, 4102, 685, 6771, 388, 363, 25552, 938, 2693, 363, 24057, 12800, 938, 3157, 6974, 15994, 938, 391, 25028, 2880, 938, 648, 9615, 938, 1302, 1478, 517, 612, 3713, 1478, 363, 1276, 662, 408, 726, 979, 363, 4689, 387, 878, 7392, 662, 408, 3037, 865, 38167, 391, 1469, 4192, 736, 1159, 8385, 387, 3445, 387, 363, 8408, 420, 18583, 21247, 19057, 4041, 517, 363, 5061, 11127, 385, 18583, 21247, 391, 837, 1153, 11874, 5061, 8666, 11808, 7367, 21745, 418, 122, 145, 12270, 10644, 420, 363, 6316, 12021, 9185, 18114, 1651, 3490, 2709, 938, 23335, 938, 358, 5061, 4977, 2801, 458, 363, 4386, 14233, 5322, 1368, 387, 2338, 6316, 16752, 1478, 9185, 18114, 938, 610, 8227, 938, 412, 100, 664, 100, 938, 468, 9146, 100, 938, 1012, 100, 175, 8820, 938, 391, 1269, 185, 1235, 8820, 1478, 24158, 468, 816, 17512, 20045, 4797, 420, 11712, 49821, 5015, 458, 884, 415, 761, 12719, 1368, 5552, 388, 363, 18233, 677, 12111, 938, 652, 6440, 385, 358, 2393, 24922, 387, 13809, 938, 39040, 385, 4320, 764, 41348, 6316, 385, 1469, 18583, 21247, 1159, 11571, 430, 363, 835, 1469, 9914, 391, 4865, 420, 6211, 5350, 1734, 14070, 458, 20277, 1368, 938, 1491, 5294, 8587, 523, 363, 818, 6870, 865, 484, 818, 6870, 474, 385, 408, 363, 4266, 1469, 938, 1082, 363, 1319, 6870, 474, 385, 1469, 16752, 456, 764, 818, 9533, 391, 4731, 21673, 456, 764, 1319, 938, 452, 3445, 26414, 456, 363, 2469, 2597, 865, 484, 818, 6870, 5382, 850, 387, 363, 3878, 385, 1469, 3240, 8038, 938, 8485, 21006, 16674, 6095, 10596, 17890, 7433, 532, 22538, 644, 648, 3663, 452, 382, 3199, 113, 2588, 9131, 391, 358, 475, 41787, 7653, 427, 1410, 707, 8177, 388, 19438, 1761, 865, 484, 1734, 6199, 15616, 648, 6250, 385, 3023, 363, 4612, 2089, 6771, 458, 3445, 26414, 391, 6316, 16752, 1368, 494, 938, 712, 878, 648, 508, 2045, 938, 698, 685, 1130, 2089, 8038, 458, 4731, 21673, 391, 11512, 21301, 1368, 865, 3375, 6870, 15748, 26228, 648, 385, 1469, 2424, 6771, 865, 29266, 648, 6250, 385, 1066, 8736, 391, 4218, 456, 968, 19685, 6316, 456, 1845, 385, 4256, 585, 851, 508, 752, 757, 363, 1734, 385, 15889, 363, 26228, 938, 2693, 388, 363, 818, 6870, 865, 1750, 363, 8587, 806, 5353, 1493, 1978, 585, 648, 385, 47975, 480, 363, 6316, 16752, 391, 1542, 385, 5350, 865, 29266, 648, 385, 4792, 20277, 10842, 911, 2723, 938, 2693, 726, 572, 114, 151, 114, 1734, 25848, 865, 7514, 363, 1469, 32501, 938, 835, 39572, 6316, 5712, 523, 4731, 21673, 710, 1235, 7588, 391, 45463, 648, 2009, 385, 24591, 726, 541, 12297, 391, 6770, 9120, 391, 1090, 420, 572, 114, 151, 114, 11127, 11843, 391, 4168, 865, 3412, 31640, 6316, 14057, 42280, 321, 36314, 990, 363, 572, 114, 151, 114, 938, 391, 648, 508, 3407, 865, 572, 114, 151, 114, 11127, 11843, 391, 5698, 1209, 1422, 388, 18583, 21247, 474, 1642, 2001, 2334, 385, 363, 3237, 387, 363, 5061, 14098, 7315, 179, 28664, 40499, 865, 418, 1090, 387, 363, 8990, 387, 363, 572, 114, 151, 114, 11127, 388, 30794, 42284, 12720, 5046, 673, 6770, 9120, 474, 2823, 523, 363, 11127, 25028, 415, 633, 7825, 865, 6124, 1541, 24591, 13117, 1559, 8476, 363, 2090, 1123, 363, 5061, 12021, 2801, 458, 363, 16929, 100, 988, 1973, 1368, 391, 11657, 4550, 660, 938, 385, 4987, 698, 3854, 20459, 865, 3935, 3977, 1228, 20102, 34132, 415, 633, 1568, 938, 415, 633, 1349, 938, 415, 633, 1261, 938, 415, 633, 2635, 938, 391, 415, 633, 2088, 1224, 36486, 358, 6095, 418, 386, 17585, 25028, 430, 4940, 385, 363, 10251, 673, 541, 12297, 865, 484, 2037, 415, 633, 16760, 1465, 610, 596, 20919, 5766, 420, 3490, 1780, 938, 23335, 865, 1651, 3527, 819, 938, 585, 1726, 385, 1727, 939, 400, 11733, 458, 779, 10672, 2263, 1206, 21605, 1368, 387, 363, 5523, 387, 18583, 21247, 391, 5712, 612, 386, 17585, 6453, 480, 647, 5635, 1159, 3672, 420, 3527, 868, 865, 1730, 7744, 1159, 5534, 29928, 3963, 938, 363, 6265, 2133, 41379, 1583, 40281, 13590, 358, 386, 17585, 25028, 380, 33543, 30083, 26384, 387, 363, 18583, 21247, 10485, 36776, 391, 28709, 363, 41157, 12251, 865, 484, 386, 17585, 844, 524, 6083, 18583, 21247, 865, 2203, 938, 12251, 30996, 1295, 386, 17585, 25028, 480, 9231, 1159, 5315, 388, 363, 818, 1706, 7035, 388, 363, 8312, 22308, 865, 418, 386, 17585, 25028, 420, 363, 5194, 1836, 387, 8193, 5552, 6926, 363, 5518, 14483, 15504, 19670, 848, 452, 708, 818, 39124, 391, 6926, 363, 9375, 41157, 2993, 45210, 452, 708, 685, 631, 979, 953, 24891, 517, 2993, 45210, 480, 8588, 1159, 6047, 865, 418, 2469, 386, 17585, 25028, 938, 9499, 633, 779, 938, 22905, 5504, 938, 1853, 2455, 363, 25552, 10485, 391, 858, 420, 363, 7728, 1836, 387, 541, 12297, 938, 911, 441, 474, 8008, 420, 3527, 908, 865, 2140, 12784, 16486, 20996, 13332, 422, 8283, 1610, 422, 45918, 391, 474, 8008, 517, 13809, 2452, 5033, 2845, 35839, 3372, 9185, 9120, 938, 5134, 363, 818, 5061, 17335, 387, 1276, 865, 418, 5645, 651, 688, 9795, 517, 358, 6896, 3978, 1469, 391, 474, 10059, 517, 764, 5563, 979, 441, 815, 2147, 764, 7433, 532, 22538, 865, 5061, 3487, 2823, 358, 5344, 3376, 523, 358, 386, 17585, 25028, 480, 3672, 1159, 6174, 420, 3527, 908, 8613, 2566, 385, 631, 494, 618, 1689, 44405, 2742, 18583, 21247, 865, 655, 9869, 938, 4852, 938, 391, 5979, 938, 13809, 4799, 8684, 5093, 18744, 321, 439, 951, 11157, 18865, 1144, 363, 15329, 387, 363, 8251, 386, 17585, 25028, 9206, 388, 1216, 3455, 2455, 18583, 21247, 865, 484, 15329, 474, 388, 363, 16569, 2315, 911, 982, 18302, 572, 114, 151, 114, 5213, 474, 24206, 807, 363, 1276, 938, 1491, 5773, 391, 9682, 6078, 865, 5848, 387, 764, 7433, 532, 22538, 648, 4915, 865, 871, 42668, 452, 3237, 387, 835, 7433, 532, 22538, 6395, 480, 363, 1758, 35340, 621, 114, 5694, 480, 939, 1159, 8803, 480, 363, 10485, 387, 18583, 21247, 938, 391, 358, 1845, 39124, 6395, 480, 41157, 28452, 480, 8588, 1159, 2411, 865, 5061, 14406, 387, 1276, 4192, 736, 1159, 5061, 1276, 6842, 484, 1469, 1819, 1396, 979, 698, 8867, 14406, 387, 1276, 474, 1026, 517, 2970, 938, 576, 529, 474, 508, 24747, 14164, 25485, 321, 439, 6879, 865, 780, 6299, 22212, 4918, 427, 363, 1469, 916, 508, 23139, 1667, 12378, 2532, 807, 2970, 651, 8082], "start_token": 2486, "end_token": 2489, "category": 1}
|
{"input_ids": [65, 609, 6250, 363, 575, 2775, 2872, 1469, 420, 43937, 25552, 66, 11307, 382, 4896, 10895, 387, 363, 7664, 4012, 679, 41561, 391, 385, 25234, 523, 3393, 8940, 938, 2911, 578, 685, 7128, 321, 29203, 1151, 10634, 865, 2770, 8707, 878, 11729, 865, 5061, 5638, 4240, 610, 30042, 6049, 889, 4539, 385, 1927, 452, 19398, 938, 576, 19398, 11290, 420, 9079, 382, 4482, 979, 698, 3350, 865, 484, 572, 114, 151, 114, 14892, 385, 2970, 7931, 11744, 19398, 385, 2554, 363, 3350, 938, 6610, 427, 441, 474, 363, 792, 936, 385, 12302, 363, 1774, 2504, 2971, 610, 30042, 6049, 1331, 391, 4268, 388, 363, 8312, 865, 2203, 938, 566, 15703, 474, 508, 13235, 2503, 865, 484, 610, 30042, 6049, 1331, 14808, 363, 1809, 1328, 938, 719, 363, 5061, 2523, 8707, 358, 15321, 387, 578, 6654, 523, 2908, 865, 2970, 321, 439, 2558, 7062, 938, 6894, 420, 3490, 1261, 938, 4539, 385, 8500, 523, 8473, 1524, 5475, 1538, 391, 385, 25234, 523, 3535, 388, 21300, 7330, 938, 624, 991, 456, 363, 1679, 1930, 938, 1679, 7627, 938, 391, 12772, 24469, 6234, 385, 2908, 391, 13764, 612, 9489, 1129, 2970, 865, 484, 1706, 3854, 113, 1777, 40108, 387, 3490, 2709, 458, 3490, 2782, 388, 2970, 1368, 938, 363, 28339, 3566, 938, 2773, 2970, 3291, 36417, 2908, 1332, 3504, 391, 13897, 1830, 113, 464, 32484, 380, 8757, 452, 8312, 5736, 865, 1651, 3490, 2709, 388, 2970, 938, 363, 1211, 979, 363, 3566, 321, 439, 7686, 938, 363, 5061, 4977, 2801, 1465, 2594, 430, 18583, 21247, 865, 12943, 5511, 28988, 38530, 5511, 430, 382, 1469, 420, 18583, 21247, 385, 1906, 363, 1546, 757, 363, 7660, 8151, 20958, 9599, 10249, 458, 363, 5061, 3482, 430, 363, 11015, 3788, 42657, 391, 21300, 7330, 4244, 1368, 651, 9359, 946, 2004, 388, 23335, 840, 363, 45163, 1164, 387, 24747, 1249, 374, 11702, 14164, 25485, 938, 889, 25872, 2970, 321, 439, 32129, 20102, 865, 780, 1940, 456, 34187, 385, 8867, 5511, 391, 3148, 430, 382, 1469, 523, 363, 11874, 5061, 8666, 3712, 10084, 792, 807, 982, 22728, 452, 20919, 32294, 938, 1491, 358, 2473, 385, 11032, 566, 3242, 865, 6563, 633, 5147, 5511, 474, 17816, 517, 2004, 6177, 23335, 938, 7626, 517, 30245, 24747, 11190, 100, 178, 46015, 49421, 8231, 938, 452, 6930, 523, 8700, 1956, 27887, 503, 7539, 391, 14164, 25485, 321, 439, 15211, 6054, 387, 10084, 938, 8700, 12771, 27307, 18233, 3869, 8184, 865, 484, 33697, 9814, 363, 16337, 3618, 1734, 1469, 420, 363, 8301, 11127, 480, 14211, 14824, 17610, 2381, 865, 3928, 363, 1407, 1912, 2034, 938, 15083, 648, 8877, 938, 5213, 474, 16674, 938, 391, 4531, 474, 7824, 865, 8046, 878, 21619, 938, 10952, 29480, 1320, 10195, 851, 508, 14863, 363, 1469, 1511, 1667, 3490, 743, 938, 807, 363, 2469, 387, 1541, 11874, 7427, 5073, 1545, 385, 2175, 363, 2401, 865, 8226, 19702, 474, 508, 1914, 517, 363, 23230, 1667, 3527, 453, 938, 807, 358, 3842, 387, 5061, 2867, 13131, 784, 363, 7660, 28339, 5841, 10249, 662, 7660, 4218, 363, 16022, 387, 363, 2908, 4620, 938, 35377, 1970, 46120, 20996, 391, 16738, 5061, 1731, 387, 5070, 865, 10249, 2851, 2840, 23335, 938, 968, 18085, 4863, 427, 39183, 1123, 363, 572, 114, 151, 114, 391, 2970, 648, 21262, 865, 418, 29284, 3379, 756, 979, 363, 1469, 420, 18583, 21247, 1144, 427, 6841, 4165, 387, 3500, 3039, 1276, 452, 2970, 938, 2782, 4165, 851, 508, 938, 391, 2411, 4165, 651, 746, 4560, 865, 2994, 572, 114, 151, 114, 8312, 12637, 391, 7392, 651, 688, 4725, 420, 8096, 420, 968, 12533, 938, 572, 114, 151, 114, 2929, 37205, 18583, 21247, 662, 408, 363, 818, 2597, 2263, 2528, 938, 585, 3039, 363, 13417, 662, 408, 7485, 818, 865, 871, 35568, 474, 2334, 385, 363, 2473, 427, 363, 1734, 12637, 3791, 363, 1600, 391, 363, 19115, 2880, 480, 31822, 15560, 385, 5518, 15397, 938, 456, 981, 456, 385, 363, 28753, 387, 9517, 385, 2970, 523, 7775, 385, 363, 5467, 865, 1220, 736, 23276, 4863, 427, 2970, 474, 508, 6108, 387, 17361, 618, 722, 631, 1789, 19115, 5006, 480, 358, 741, 865, 9616, 1184, 484, 5061, 1469, 651, 1912, 1789, 12132, 865, 3375, 938, 441, 5393, 385, 4218, 1694, 1706, 11127, 5092, 938, 12940, 12275, 363, 8312, 20102, 523, 32975, 452, 5061, 29280, 387, 363, 11015, 3788, 42657, 391, 4535, 11830, 391, 385, 7240, 2970, 385, 23976, 21300, 7330, 1332, 14618, 865, 5599, 938, 441, 474, 10820, 385, 2923, 741, 430, 2970, 385, 38663, 764, 2393, 391, 2721, 764, 19115, 4303, 979, 4175, 16995, 10536, 517, 363, 16337, 670, 8000, 633, 24205, 2292, 33689, 698, 2964, 387, 5474, 865, 10568, 938, 385, 5304, 358, 6712, 385, 2354, 321, 439, 2795, 385, 43595, 764, 3487, 388, 363, 8312, 938, 3445, 26414, 648, 7248, 456, 363, 1489, 6771, 938, 1302, 585, 648, 363, 29164, 8038, 387, 698, 24057, 480, 363, 741, 865, 9562, 938, 441, 474, 10820, 427, 363, 1469, 662, 16738, 1706, 29752, 985, 427, 363, 572, 114, 151, 114, 1331, 662, 4369, 764, 8766, 10489, 385, 5061, 5454, 938, 391, 662, 5481, 358, 13211, 4268, 452, 2970, 865, 4386, 14233, 363, 8312, 20102, 480, 18122, 388, 18583, 21247, 5382, 835, 7411, 38558, 1159, 363, 8078, 8038, 662, 408, 388, 946, 19438, 1761, 938, 624, 441, 662, 408, 5466, 2663, 385, 32605, 391, 5558, 9286, 707, 2263, 391, 850, 387, 363, 19037, 662, 7967, 363, 1469, 938, 1302, 968, 662, 408, 420, 15292, 2767, 494, 662, 408, 19969, 523, 363, 25552, 865, 418, 2353, 1694, 21508, 1478, 529, 387, 10677, 938, 391, 2001, 385, 363, 5061, 1478, 474, 363, 8990, 523, 18583, 21247, 387, 578, 1216, 387, 363, 572, 114, 151, 114, 8312, 20102, 321, 439, 6316, 16752, 458, 15074, 938, 39641, 938, 391, 412, 34275, 11050, 1368, 865, 321, 23953, 146, 1454, 3242, 474, 7324, 385, 24747, 438, 19311, 321, 439, 7660, 21213, 3445, 10249, 13216, 938, 2693, 427, 387, 13998, 363, 5516, 1372, 387, 3445, 26414, 865, 8046, 878, 4887, 938, 14164, 25485, 3167, 385, 1904, 4159, 865, 5061, 6729, 388, 612, 2795, 385, 4721, 358, 1891, 938, 32057, 1276, 736, 4102, 685, 6771, 388, 363, 25552, 938, 2693, 363, 24057, 12800, 938, 3157, 6974, 15994, 938, 391, 25028, 2880, 938, 648, 9615, 938, 1302, 1478, 517, 612, 3713, 1478, 363, 1276, 662, 408, 726, 979, 363, 4689, 387, 878, 7392, 662, 408, 3037, 865, 38167, 391, 1469, 4192, 736, 1159, 8385, 387, 3445, 387, 363, 8408, 420, 18583, 21247, 19057, 4041, 517, 363, 5061, 11127, 385, 18583, 21247, 391, 837, 1153, 11874, 5061, 8666, 11808, 7367, 21745, 418, 122, 145, 12270, 10644, 420, 363, 6316, 12021, 9185, 18114, 1651, 3490, 2709, 938, 23335, 938, 358, 5061, 4977, 2801, 458, 363, 4386, 14233, 5322, 1368, 387, 2338, 6316, 16752, 1478, 9185, 18114, 938, 610, 8227, 938, 412, 100, 664, 100, 938, 468, 9146, 100, 938, 1012, 100, 175, 8820, 938, 391, 1269, 185, 1235, 8820, 1478, 24158, 468, 816, 17512, 20045, 4797, 420, 11712, 49821, 5015, 458, 884, 415, 761, 12719, 1368, 5552, 388, 363, 18233, 677, 12111, 938, 652, 6440, 385, 358, 2393, 24922, 387, 13809, 938, 39040, 385, 4320, 764, 41348, 6316, 385, 1469, 18583, 21247, 1159, 11571, 430, 363, 835, 1469, 9914, 391, 4865, 420, 6211, 5350, 1734, 14070, 458, 20277, 1368, 938, 1491, 5294, 8587, 523, 363, 818, 6870, 865, 484, 818, 6870, 474, 385, 408, 363, 4266, 1469, 938, 1082, 363, 1319, 6870, 474, 385, 1469, 16752, 456, 764, 818, 9533, 391, 4731, 21673, 456, 764, 1319, 938, 452, 3445, 26414, 456, 363, 2469, 2597, 865, 484, 818, 6870, 5382, 850, 387, 363, 3878, 385, 1469, 3240, 8038, 938, 8485, 21006, 16674, 6095, 10596, 17890, 7433, 532, 22538, 644, 648, 3663, 452, 382, 3199, 113, 2588, 9131, 391, 358, 475, 41787, 7653, 427, 1410, 707, 8177, 388, 19438, 1761, 865, 484, 1734, 6199, 15616, 648, 6250, 385, 3023, 363, 4612, 2089, 6771, 458, 3445, 26414, 391, 6316, 16752, 1368, 494, 938, 712, 878, 648, 508, 2045, 938, 698, 685, 1130, 2089, 8038, 458, 4731, 21673, 391, 11512, 21301, 1368, 865, 3375, 6870, 15748, 26228, 648, 385, 1469, 2424, 6771, 865, 29266, 648, 6250, 385, 1066, 8736, 391, 4218, 456, 968, 19685, 6316, 456, 1845, 385, 4256, 585, 851, 508, 752, 757, 363, 1734, 385, 15889, 363, 26228, 938, 2693, 388, 363, 818, 6870, 865, 1750, 363, 8587, 806, 5353, 1493, 1978, 585, 648, 385, 47975, 480, 363, 6316, 16752, 391, 1542, 385, 5350, 865, 29266, 648, 385, 4792, 20277, 10842, 911, 2723, 938, 2693, 726, 572, 114, 151, 114, 1734, 25848, 865, 7514, 363, 1469, 32501, 938, 835, 39572, 6316, 5712, 523, 4731, 21673, 710, 1235, 7588, 391, 45463, 648, 2009, 385, 24591, 726, 541, 12297, 391, 6770, 9120, 391, 1090, 420, 572, 114, 151, 114, 11127, 11843, 391, 4168, 865, 3412, 31640, 6316, 14057, 42280, 321, 36314, 990, 363, 572, 114, 151, 114, 938, 391, 648, 508, 3407, 865, 572, 114, 151, 114, 11127, 11843, 391, 5698, 1209, 1422, 388, 18583, 21247, 474, 1642, 2001, 2334, 385, 363, 3237, 387, 363, 5061, 14098, 7315, 179, 28664, 40499, 865, 418, 1090, 387, 363, 8990, 387, 363, 572, 114, 151, 114, 11127, 388, 30794, 42284, 12720, 5046, 673, 6770, 9120, 474, 2823, 523, 363, 11127, 25028, 415, 633, 7825, 865, 6124, 1541, 24591, 13117, 1559, 8476, 363, 2090, 1123, 363, 5061, 12021, 2801, 458, 363, 16929, 100, 988, 1973, 1368, 391, 11657, 4550, 660, 938, 385, 4987, 698, 3854, 20459, 865, 3935, 3977, 1228, 20102, 34132, 415, 633, 1568, 938, 415, 633, 1349, 938, 415, 633, 1261, 938, 415, 633, 2635, 938, 391, 415, 633, 2088, 1224, 36486, 358, 6095, 418, 386, 17585, 25028, 430, 4940, 385, 363, 10251, 673, 541, 12297, 865, 484, 2037, 415, 633, 16760, 1465, 610, 596, 20919, 5766, 420, 3490, 1780, 938, 23335, 865, 1651, 3527, 819, 938, 585, 1726, 385, 1727, 939, 400, 11733, 458, 779, 10672, 2263, 1206, 21605, 1368, 387, 363, 5523, 387, 18583, 21247, 391, 5712, 612, 386, 17585, 6453, 480, 647, 5635, 1159, 3672, 420, 3527, 868, 865, 1730, 7744, 1159, 5534, 29928, 3963, 938, 363, 6265, 2133, 41379, 1583, 40281, 13590, 358, 386, 17585, 25028, 380, 33543, 30083, 26384, 387, 363, 18583, 21247, 10485, 36776, 391, 28709, 363, 41157, 12251, 865, 484, 386, 17585, 844, 524, 6083, 18583, 21247, 865, 2203, 938, 12251, 30996, 1295, 386, 17585, 25028, 480, 9231, 1159, 5315, 388, 363, 818, 1706, 7035, 388, 363, 8312, 22308, 865, 418, 386, 17585, 25028, 420, 363, 5194, 1836, 387, 8193, 5552, 6926, 363, 5518, 14483, 15504, 19670, 848, 452, 708, 818, 39124, 391, 6926, 363, 9375, 41157, 2993, 45210, 452, 708, 685, 631, 979, 953, 24891, 517, 2993, 45210, 480, 8588, 1159, 6047, 865, 418, 2469, 386, 17585, 25028, 938, 9499, 633, 779, 938, 22905, 5504, 938, 1853, 2455, 363, 25552, 10485, 391, 858, 420, 363, 7728, 1836, 387, 541, 12297, 938, 911, 441, 474, 8008, 420, 3527, 908, 865, 2140, 12784, 16486, 20996, 13332, 422, 8283, 1610, 422, 45918, 391, 474, 8008, 517, 13809, 2452, 5033, 2845, 35839, 3372, 9185, 9120, 938, 5134, 363, 818, 5061, 17335, 387, 1276, 865, 418, 5645, 651, 688, 9795, 517, 358, 6896, 3978, 1469, 391, 474, 10059, 517, 764, 5563, 979, 441, 815, 2147, 764, 7433, 532, 22538, 865, 5061, 3487, 2823, 358, 5344, 3376, 523, 358, 386, 17585, 25028, 480, 3672, 1159, 6174, 420, 3527, 908, 8613, 2566, 385, 631, 494, 618, 1689, 44405, 2742, 18583, 21247, 865, 655, 9869, 938, 4852, 938, 391, 5979, 938, 13809, 4799, 8684, 5093, 18744, 321, 439, 951, 11157, 18865, 1144, 363, 15329, 387, 363, 8251, 386, 17585, 25028, 9206, 388, 1216, 3455, 2455, 18583, 21247, 865, 484, 15329, 474, 388, 363, 16569, 2315, 911, 982, 18302, 572, 114, 151, 114, 5213, 474, 24206, 807, 363, 1276, 938, 1491, 5773, 391, 9682, 6078, 865, 5848, 387, 764, 7433, 532, 22538, 648, 4915, 865, 871, 42668, 452, 3237, 387, 835, 7433, 532, 22538, 6395, 480, 363, 1758, 35340, 621, 114, 5694, 480, 939, 1159, 8803, 480, 363, 10485, 387, 18583, 21247, 938, 391, 358, 1845, 39124, 6395, 480, 41157, 28452, 480, 8588, 1159, 2411, 865, 5061, 14406, 387, 1276, 4192, 736, 1159, 5061, 1276, 6842, 484, 1469, 1819, 1396, 979, 698, 8867, 14406, 387, 1276, 474, 1026, 517, 2970, 938, 576, 529, 474, 508, 24747, 14164, 25485, 321, 439, 6879, 865, 780, 6299, 22212, 4918, 427, 363, 1469, 916, 508, 23139, 1667, 12378, 2532, 807, 2970, 651, 8082, 363, 1679, 1930, 427, 4268, 9926, 648, 480, 382, 987, 865, 2203, 938, 363, 1469, 2641, 979, 363, 4104, 815, 408, 6894, 865, 11891, 18408, 363, 23437, 633, 1674, 14584, 458, 8912, 1545, 363, 7660, 1579, 633, 2243, 16101, 10249, 1368, 388, 835, 7122, 385, 363, 5061, 23334, 388, 2770, 865, 410, 2697, 1517, 23199, 363, 3376, 1819, 1266, 991, 430, 363, 5061, 14892, 385, 5304, 441, 420, 7370, 2263, 388, 363, 1886, 938, 441, 474, 508, 5646, 1667, 618, 722, 382, 1812, 807, 363, 1469, 2641, 865, 458, 655, 1210, 938, 572, 114, 151, 114, 2539, 321, 49396, 651, 1642, 976, 642, 6184, 391, 14352, 850, 387, 363, 3376, 2351, 979, 440, 474, 7631, 385, 5304, 441, 865, 1368, 484, 2558, 737, 419, 3461, 3518, 456, 358, 14406, 387, 1276, 865, 2994, 441, 474, 9670, 517, 358, 1372, 387, 4765, 572, 114, 151, 1331, 391, 2523, 2929, 456, 358, 946, 2014, 17017, 9926, 648, 1985, 385, 408, 23184, 391, 427, 1276, 1345, 2371, 604, 480, 698, 2690, 938, 441, 6260, 6976, 1276, 4350, 32261, 13194, 2417, 865, 418, 14406, 387, 1276, 474, 10499, 420, 363, 2267, 2544, 387, 2970, 321, 439, 14842, 388, 363, 6281, 8414, 387, 3527, 908, 938, 576, 508, 6894, 385, 363, 572, 114, 151, 114, 1331, 1667, 363, 1211, 807, 363, 1469, 865, 1215, 4748, 938, 10325, 11602, 2815, 427, 2970, 7485, 1332, 818, 15933, 7264, 13194, 2417, 792, 881, 387, 17491, 391, 376, 14840, 427, 11139, 363, 7686, 387, 358, 3289, 321, 20180, 990, 480, 1276, 385, 2770, 865, 655, 7459, 938, 2259, 938, 7315, 179, 28919, 22301, 938, 358, 6341, 387, 1200, 391, 3331, 2417, 480, 4138, 4403, 2160, 388, 11891, 938, 5172, 5064, 427, 6336, 385, 358, 31644, 4485, 2742, 363, 1331, 726, 804, 938, 391, 5701, 1872, 938, 385, 19462, 2770, 387, 2970, 321, 439, 6879, 385, 2371, 673, 9926, 391, 1024, 358, 1276, 938, 1491, 358, 3527, 868, 5827, 388, 363, 1276, 26440, 2383, 938, 7660, 458, 541, 1368, 3057, 34137, 25583, 419, 18535, 18889, 3913, 2044, 865, 10249, 3327, 529, 938, 28919, 22301, 632, 938, 7660, 484, 26440, 2624, 427, 363, 5529, 391, 24057, 851, 508, 866, 385, 1678, 698, 1875, 14406, 387, 1276, 938, 494, 5701, 3262, 4104, 873, 387, 363, 19984, 387, 9926, 2745, 391, 585, 4185, 34530, 865, 10249, 655, 698, 1886, 938, 873, 712, 363, 5061, 651, 491, 41077, 391, 6894, 363, 1579, 633, 2243, 16101, 979, 363, 3827, 387, 363, 1469, 938, 441, 662, 508, 524, 27377, 2136, 358, 8867, 2371, 387, 13194, 2417, 494, 358, 14406, 387, 1276, 865, 484, 2558, 835, 23650, 387, 363, 3376, 1201, 1159, 6761, 363, 23277, 3012, 387, 363, 5061, 5171, 385, 4633, 5061, 633, 1706, 2417, 391, 385, 12302, 391, 7820, 363, 4268, 387, 363, 8312, 933, 11214, 452, 363, 1706, 5171, 569, 3544, 688, 2727, 865, 484, 5061, 5171, 30191, 385, 524, 385, 19462, 29477, 363, 1706, 5171, 427, 388, 1671, 387, 363, 9509, 387, 363, 1706, 5171, 441, 561, 508, 576, 2175, 427, 441, 419, 5441, 385, 3252, 382, 4482, 933, 2353, 9926, 865, 3375, 6870, 11843, 484, 5061, 7485, 388, 835, 9914, 865, 484, 818, 6870, 474, 12427, 517, 572, 114, 151, 114, 5508, 13529, 480, 21157, 400, 37174, 4709, 458, 25365, 10672, 1368, 938, 576, 474, 3085, 19208, 456, 1395, 38641, 26228, 14921, 523, 363, 1706, 22880, 5950, 1159, 418, 114, 8193, 5552, 7311, 448, 114, 42542, 422, 7764, 428, 114, 7560, 1767, 7764, 461, 114, 27613, 7764, 513, 114, 20156, 179, 359, 7311, 477, 114, 513, 10348, 13223, 2022, 472, 633, 453, 865, 8771, 2372, 38527, 9428, 472, 633, 463, 865, 23144, 704, 12263, 19441, 472, 633, 614, 865, 610, 7353, 7010, 19441, 503, 114, 11124, 20396, 10348, 468, 114, 38899, 33364, 415, 114, 471, 32911, 7010, 550, 114, 20156, 179, 359, 610, 114, 43397, 758, 865, 448, 633, 1697, 183, 523, 22880, 453, 865, 3375, 5688, 1549, 453, 633, 453, 865, 5785, 26228, 453, 1478, 463, 865, 410, 16401, 24858, 26228, 453, 1478, 614, 865, 39218, 26228, 463, 865, 5599, 5688, 1549, 463, 633, 453, 865, 5785, 26228, 463, 633, 453, 138, 865, 29266, 463, 633, 463, 865, 39218, 26228, 24631, 1159, 418, 114, 20542, 5552, 448, 114, 7316, 1115, 12111, 428, 114, 29073, 5552, 461, 114, 13809, 461, 633, 453, 865, 541, 12297, 453, 865, 23217, 39641, 463, 865, 23217, 15074, 614, 865, 3375, 3802, 20102, 1380, 2411, 3726, 458, 819, 114, 120, 386, 1368, 2635, 1478, 2343, 3726, 458, 819, 114, 123, 1478, 868, 114, 116, 386, 1368, 2909, 3726, 458, 908, 114, 124, 386, 1368, 1643, 1478, 4034, 3726, 458, 961, 114, 117, 1478, 961, 114, 124, 386, 1368, 4848, 1478, 5075, 3726, 458, 939, 114, 117, 1478, 939, 114, 120, 386, 1368, 5075, 1478, 3540, 3726, 458, 939, 114, 120, 1478, 939, 114, 123, 386, 1368, 4671, 1478, 5315, 3726, 458, 1468, 114, 116, 1478, 1468, 114, 119, 386, 1368, 4454, 1478, 5115, 3726, 458, 1468, 114, 122, 1478, 1468, 114, 125, 386, 1368, 2420, 1478, 6174, 3726, 458, 1206, 114, 118, 1478, 1206, 114, 121, 386, 1368, 5534, 1478, 4865, 3726, 458, 1206, 114, 124, 1478, 1579, 114, 122, 386, 1368, 1976, 5226, 3726, 458, 1579, 114, 125, 386, 1368, 2355, 5508, 2880, 8666, 2880, 3561, 6122, 6771, 1159, 453, 1159, 23217, 3543, 463, 1159, 23217, 10870, 614, 1159, 23217, 10534, 705, 1159, 23217, 11388, 743, 1159, 23217, 2789, 6126, 819, 1159, 23217, 8044, 868, 1159, 23217, 12188, 908, 1159, 23217, 9690, 961, 1159, 8193, 5552, 7311, 939, 1159, 42542, 422, 2315, 16684, 1951, 6985, 6771, 1159, 418, 1159, 11575, 6244, 11758, 448, 1159, 428, 30259, 45039, 10144, 2716, 428, 1159, 3935, 42481, 2880, 461, 126, 8666, 30923, 484, 818, 1469, 6870, 387, 28652, 13117, 474, 5712, 5194, 387, 541, 12297, 938, 3058, 517, 13454, 22525, 20996, 477, 895, 3856, 865, 9800, 13117, 4155, 385, 4320, 2334, 385, 6377, 13257, 865, 733, 3118, 1159, 453, 402, 5013, 458, 6771, 1159, 3445, 26414, 391, 6316, 16752, 1368, 5226, 22356, 1329, 8184, 448, 121, 146, 16794, 26228, 7037, 452, 10561, 14312, 458, 453, 40862, 18461, 1368, 8429, 633, 30763, 12235, 938, 8490, 388, 1541, 9105, 458, 453, 4155, 385, 4320, 1368, 2420, 448, 121, 146, 26228, 7037, 452, 6095, 10596, 7433, 532, 22538, 938, 736, 388, 1541, 9105, 463, 459, 5013, 1478, 458, 6771, 1159, 8193, 5552, 391, 27613, 7764, 1368, 6986, 418, 16691, 461, 119, 133, 3355, 15748, 26228, 7037, 452, 25341, 18461, 458, 34721, 14312, 1368, 2377, 633, 4108, 12235, 458, 614, 4155, 385, 4320, 1368, 614, 4473, 5013, 1478, 458, 6771, 1159, 6316, 480, 8193, 5552, 938, 42542, 422, 7764, 938, 27613, 7764, 938, 35439, 321, 439, 6353, 938, 20156, 179, 359, 1368, 6047, 11808, 7367, 21745, 418, 122, 145, 7660, 12270, 10249, 8587, 430, 1734, 1731, 391, 3635, 28926, 458, 463, 4155, 385, 4320, 1368, 1182, 363, 818, 6870, 10549, 541, 12297, 938, 441, 474, 12427, 517, 363, 572, 114, 151, 114, 5508, 412, 9520, 633, 20580, 13529, 480, 8771, 2372, 6353, 1575, 363, 7123, 321, 439, 7941, 8272, 865, 871, 1382, 651, 688, 388, 3148, 4336, 430, 2034, 938, 576, 474, 508, 1966, 14020, 865, 484, 12980, 938, 9344, 790, 4603, 30552, 7605, 114, 391, 7313, 13757, 547, 938, 2199, 358, 2597, 865, 988, 21687, 17438, 2882, 418, 114, 14987, 938, 358, 8409, 8787, 3919, 480, 363, 44823, 34838, 37228, 3438, 938, 25852, 441, 474, 363, 7631, 10426, 387, 2338, 448, 633, 1697, 26228, 523, 3543, 865, 484, 5061, 13117, 648, 13986, 523, 358, 4672, 946, 2070, 458, 792, 358, 1279, 7471, 3681, 1368, 385, 363, 26228, 938, 391, 1082, 363, 12980, 651, 1340, 1876, 358, 10079, 456, 1689, 420, 13529, 938, 585, 24108, 385, 1661, 14987, 387, 764, 2647, 865, 14987, 938, 430, 2425, 3941, 938, 815, 508, 1661, 363, 12980, 387, 363, 2338, 448, 633, 1697, 183, 427, 648, 2334, 458, 873, 1097, 441, 474, 6869, 2001, 1368, 865, 1182, 363, 818, 6870, 13117, 10549, 541, 12297, 938, 585, 13057, 391, 2924, 967, 1912, 572, 114, 151, 114, 6316, 865, 1730, 1652, 631, 387, 878, 5344, 377, 358, 6555, 44338, 8435, 6610, 865, 3920, 14702, 523, 8038, 673, 363, 25552, 10485, 648, 1092, 953, 13787, 494, 21960, 12742, 719, 363, 9375, 13117, 2641, 13572, 391, 3635, 28926, 865, 16034, 938, 441, 419, 508, 1699, 698, 14702, 662, 524, 651, 982, 1346, 873, 712, 585, 651, 688, 16274, 9481, 391, 982, 618, 19369, 865, 484, 2583, 363, 5061, 8894, 388, 363, 13417, 648, 7087, 363, 1077, 456, 480, 18583, 21247, 938, 1097, 46727, 651, 2149, 5294, 2351, 6610, 427, 363, 5061, 651, 1642, 7485, 18583, 21247, 865, 484, 1734, 7004, 387, 363, 1469, 2641, 480, 868, 1159, 4865, 358, 114, 177, 114, 29928, 3963, 458, 614, 1159, 1349, 358, 114, 177, 114, 3527, 908, 5061, 9098, 3963, 938, 456, 4131, 517, 8038, 387, 363, 610, 17406, 988, 1973, 1368, 938, 452, 363, 1469, 420, 20156, 179, 359, 865, 418, 2573, 387, 47668, 5061, 13117, 388, 835, 9914, 4352, 541, 12297, 865, 19155, 938, 8927, 39124, 26228, 3058, 363, 818, 6870, 938, 29541, 363, 818, 7289, 387, 6076, 385, 1469, 363, 850, 1694, 8038, 2045, 458, 363, 3445, 26414, 1368, 938, 1082, 15748, 26228, 7485, 572, 114, 151, 114, 1734, 12637, 2074, 541, 12297, 938, 3700, 452, 42542, 422, 7764, 938, 363, 4488, 938, 391, 27613, 7764, 938, 363, 1489, 572, 114, 151, 114, 5508, 3802, 12801, 10644, 2880, 865, 484, 28470, 13117, 388, 363, 1319, 6870, 7485, 363, 5508, 3802, 12801, 806, 7560, 1767, 7764, 1575, 20156, 179, 359, 420, 363, 2445, 1005, 1836, 387, 363, 7123, 938, 391, 8193, 5552, 865, 484, 792, 17890, 5572, 1726, 523, 358, 10190, 387, 451, 633, 4671, 23546, 938, 451, 633, 2420, 1911, 27322, 938, 391, 718, 412, 14630, 461, 13069, 1304, 15748, 26228, 523, 363, 12021, 15074, 865, 418, 6673, 670, 622, 26508, 480, 513, 10348, 2315, 938, 363, 3218, 387, 631, 387, 363, 4934, 3535, 420, 363, 3265, 385, 18583, 21247, 655, 363, 818, 6870, 1469, 938, 647, 3725, 387, 363, 16672, 633, 5294, 10561, 14312, 458, 453, 40862, 18461, 1368, 8429, 633, 30763, 12235, 5811, 2378, 612, 5393, 3445, 6821, 6771, 865, 1730, 1652, 835, 387, 984, 12235, 6366, 611, 420, 3029, 938, 1295, 38855, 979, 41557, 382, 656, 1771, 1951, 6304, 938, 391, 631, 474, 358, 389, 564, 865, 637, 22631, 387, 363, 16672, 7433, 532, 22538, 2378, 3445, 26414, 938, 391, 1541, 7433, 532, 22538, 2378, 685, 8038, 865, 6166, 15601, 572, 114, 151, 114, 8038, 43464, 385, 363, 5339, 387, 36403, 938, 12235, 31091, 938, 391, 29377, 938, 21651, 7346, 661, 633, 45421, 1551, 385, 6677, 456, 585, 5067, 385, 3712, 2365, 6238, 9086, 865, 458, 484, 5964, 3376, 938, 7660, 3802, 9614, 18583, 21247, 865, 871, 419, 508, 16108, 865, 10249, 938, 474, 2009, 523, 363, 10144, 387, 21090, 13506, 5031, 938, 363, 818, 4765, 29928, 3242, 385, 3132, 865, 1368, 484, 16456, 648, 946, 45203, 865, 41512, 1280, 16050, 648, 9071, 938, 6316, 19685, 8640, 22605, 385, 8640, 22605, 388, 363, 1381, 385, 3049, 32084, 938, 6642, 35373, 458, 4945, 387, 363, 8666, 321, 439, 743, 7660, 1321, 4454, 183, 938, 792, 358, 3961, 387, 764, 4673, 6642, 938, 391, 792, 1541, 387, 3362, 5508, 13692, 1493, 388, 2324, 1368, 865, 8046, 529, 1978, 8096, 3823, 938, 968, 1706, 2523, 8314, 7183, 6941, 1242, 363, 1469, 865, 2140, 12784, 5790, 12041, 1147, 429, 7605, 114, 938, 15601, 12188, 938, 22520, 363, 4175, 321, 439, 1986, 645, 27103, 6642, 391, 474, 15153, 10758, 938, 576, 3868, 385, 408, 420, 1382, 865, 19191, 114, 13454, 477, 114, 142, 114, 5759, 22520, 12188, 388, 363, 10755, 321, 439, 8990, 391, 1493, 708, 840, 936, 1667, 363, 4175, 474, 22905, 480, 961, 1159, 939, 358, 114, 177, 114, 1982, 387, 363, 11512, 21301, 938, 418, 2746, 5505, 938, 1493, 17816, 452, 792, 1541, 3891, 15601, 938, 578, 3241, 429, 6008, 938, 4945, 452, 618, 722, 358, 715, 321, 439, 5518, 7178, 2263, 774, 12329, 480, 5518, 430, 4671, 2351, 979, 708, 25872, 3919, 5358, 385, 752, 837, 15601, 865, 8700, 438, 813, 2148, 14126, 396, 938, 25872, 2789, 6126, 938, 3058, 566, 1551, 1667, 440, 474, 2106, 967, 517, 21542, 523, 358, 5295, 644, 2378, 11388, 938, 7042, 1951, 7949, 865, 5599, 6870, 11843, 484, 1319, 6128, 6870, 20055, 387, 28470, 13117, 1159, 7276, 448, 121, 47604, 938, 9874], "start_token": 438, "end_token": 441, "category": 1}
|
{"input_ids": [65, 609, 6250, 363, 575, 2775, 2872, 1469, 420, 43937, 25552, 66, 938, 363, 1469, 2641, 979, 363, 4104, 815, 408, 6894, 865, 11891, 18408, 363, 23437, 633, 1674, 14584, 458, 8912, 1545, 363, 7660, 1579, 633, 2243, 16101, 10249, 1368, 388, 835, 7122, 385, 363, 5061, 23334, 388, 2770, 865, 410, 2697, 1517, 23199, 363, 3376, 1819, 1266, 991, 430, 363, 5061, 14892, 385, 5304, 441, 420, 7370, 2263, 388, 363, 1886, 938, 441, 474, 508, 5646, 1667, 618, 722, 382, 1812, 807, 363, 1469, 2641, 865, 458, 655, 1210, 938, 572, 114, 151, 114, 2539, 321, 49396, 651, 1642, 976, 642, 6184, 391, 14352, 850, 387, 363, 3376, 2351, 979, 440, 474, 7631, 385, 5304, 441, 865, 1368, 484, 2558, 737, 419, 3461, 3518, 456, 358, 14406, 387, 1276, 865, 2994, 441, 474, 9670, 517, 358, 1372, 387, 4765, 572, 114, 151, 1331, 391, 2523, 2929, 456, 358, 946, 2014, 17017, 9926, 648, 1985, 385, 408, 23184, 391, 427, 1276, 1345, 2371, 604, 480, 698, 2690, 938, 441, 6260, 6976, 1276, 4350, 32261, 13194, 2417, 865, 418, 14406, 387, 1276, 474, 10499, 420, 363, 2267, 2544, 387, 2970, 321, 439, 14842, 388, 363, 6281, 8414, 387, 3527, 908, 938, 576, 508, 6894, 385, 363, 572, 114, 151, 114, 1331, 1667, 363, 1211, 807, 363, 1469, 865, 1215, 4748, 938, 10325, 11602, 2815, 427, 2970, 7485, 1332, 818, 15933, 7264, 13194, 2417, 792, 881, 387, 17491, 391, 376, 14840, 427, 11139, 363, 7686, 387, 358, 3289, 321, 20180, 990, 480, 1276, 385, 2770, 865, 655, 7459, 938, 2259, 938, 7315, 179, 28919, 22301, 938, 358, 6341, 387, 1200, 391, 3331, 2417, 480, 4138, 4403, 2160, 388, 11891, 938, 5172, 5064, 427, 6336, 385, 358, 31644, 4485, 2742, 363, 1331, 726, 804, 938, 391, 5701, 1872, 938, 385, 19462, 2770, 387, 2970, 321, 439, 6879, 385, 2371, 673, 9926, 391, 1024, 358, 1276, 938, 1491, 358, 3527, 868, 5827, 388, 363, 1276, 26440, 2383, 938, 7660, 458, 541, 1368, 3057, 34137, 25583, 419, 18535, 18889, 3913, 2044, 865, 10249, 3327, 529, 938, 28919, 22301, 632, 938, 7660, 484, 26440, 2624, 427, 363, 5529, 391, 24057, 851, 508, 866, 385, 1678, 698, 1875, 14406, 387, 1276, 938, 494, 5701, 3262, 4104, 873, 387, 363, 19984, 387, 9926, 2745, 391, 585, 4185, 34530, 865, 10249, 655, 698, 1886, 938, 873, 712, 363, 5061, 651, 491, 41077, 391, 6894, 363, 1579, 633, 2243, 16101, 979, 363, 3827, 387, 363, 1469, 938, 441, 662, 508, 524, 27377, 2136, 358, 8867, 2371, 387, 13194, 2417, 494, 358, 14406, 387, 1276, 865, 484, 2558, 835, 23650, 387, 363, 3376, 1201, 1159, 6761, 363, 23277, 3012, 387, 363, 5061, 5171, 385, 4633, 5061, 633, 1706, 2417, 391, 385, 12302, 391, 7820, 363, 4268, 387, 363, 8312, 933, 11214, 452, 363, 1706, 5171, 569, 3544, 688, 2727, 865, 484, 5061, 5171, 30191, 385, 524, 385, 19462, 29477, 363, 1706, 5171, 427, 388, 1671, 387, 363, 9509, 387, 363, 1706, 5171, 441, 561, 508, 576, 2175, 427, 441, 419, 5441, 385, 3252, 382, 4482, 933, 2353, 9926, 865, 3375, 6870, 11843, 484, 5061, 7485, 388, 835, 9914, 865, 484, 818, 6870, 474, 12427, 517, 572, 114, 151, 114, 5508, 13529, 480, 21157, 400, 37174, 4709, 458, 25365, 10672, 1368, 938, 576, 474, 3085, 19208, 456, 1395, 38641, 26228, 14921, 523, 363, 1706, 22880, 5950, 1159, 418, 114, 8193, 5552, 7311, 448, 114, 42542, 422, 7764, 428, 114, 7560, 1767, 7764, 461, 114, 27613, 7764, 513, 114, 20156, 179, 359, 7311, 477, 114, 513, 10348, 13223, 2022, 472, 633, 453, 865, 8771, 2372, 38527, 9428, 472, 633, 463, 865, 23144, 704, 12263, 19441, 472, 633, 614, 865, 610, 7353, 7010, 19441, 503, 114, 11124, 20396, 10348, 468, 114, 38899, 33364, 415, 114, 471, 32911, 7010, 550, 114, 20156, 179, 359, 610, 114, 43397, 758, 865, 448, 633, 1697, 183, 523, 22880, 453, 865, 3375, 5688, 1549, 453, 633, 453, 865, 5785, 26228, 453, 1478, 463, 865, 410, 16401, 24858, 26228, 453, 1478, 614, 865, 39218, 26228, 463, 865, 5599, 5688, 1549, 463, 633, 453, 865, 5785, 26228, 463, 633, 453, 138, 865, 29266, 463, 633, 463, 865, 39218, 26228, 24631, 1159, 418, 114, 20542, 5552, 448, 114, 7316, 1115, 12111, 428, 114, 29073, 5552, 461, 114, 13809, 461, 633, 453, 865, 541, 12297, 453, 865, 23217, 39641, 463, 865, 23217, 15074, 614, 865, 3375, 3802, 20102, 1380, 2411, 3726, 458, 819, 114, 120, 386, 1368, 2635, 1478, 2343, 3726, 458, 819, 114, 123, 1478, 868, 114, 116, 386, 1368, 2909, 3726, 458, 908, 114, 124, 386, 1368, 1643, 1478, 4034, 3726, 458, 961, 114, 117, 1478, 961, 114, 124, 386, 1368, 4848, 1478, 5075, 3726, 458, 939, 114, 117, 1478, 939, 114, 120, 386, 1368, 5075, 1478, 3540, 3726, 458, 939, 114, 120, 1478, 939, 114, 123, 386, 1368, 4671, 1478, 5315, 3726, 458, 1468, 114, 116, 1478, 1468, 114, 119, 386, 1368, 4454, 1478, 5115, 3726, 458, 1468, 114, 122, 1478, 1468, 114, 125, 386, 1368, 2420, 1478, 6174, 3726, 458, 1206, 114, 118, 1478, 1206, 114, 121, 386, 1368, 5534, 1478, 4865, 3726, 458, 1206, 114, 124, 1478, 1579, 114, 122, 386, 1368, 1976, 5226, 3726, 458, 1579, 114, 125, 386, 1368, 2355, 5508, 2880, 8666, 2880, 3561, 6122, 6771, 1159, 453, 1159, 23217, 3543, 463, 1159, 23217, 10870, 614, 1159, 23217, 10534, 705, 1159, 23217, 11388, 743, 1159, 23217, 2789, 6126, 819, 1159, 23217, 8044, 868, 1159, 23217, 12188, 908, 1159, 23217, 9690, 961, 1159, 8193, 5552, 7311, 939, 1159, 42542, 422, 2315, 16684, 1951, 6985, 6771, 1159, 418, 1159, 11575, 6244, 11758, 448, 1159, 428, 30259, 45039, 10144, 2716, 428, 1159, 3935, 42481, 2880, 461, 126, 8666, 30923, 484, 818, 1469, 6870, 387, 28652, 13117, 474, 5712, 5194, 387, 541, 12297, 938, 3058, 517, 13454, 22525, 20996, 477, 895, 3856, 865, 9800, 13117, 4155, 385, 4320, 2334, 385, 6377, 13257, 865, 733, 3118, 1159, 453, 402, 5013, 458, 6771, 1159, 3445, 26414, 391, 6316, 16752, 1368, 5226, 22356, 1329, 8184, 448, 121, 146, 16794, 26228, 7037, 452, 10561, 14312, 458, 453, 40862, 18461, 1368, 8429, 633, 30763, 12235, 938, 8490, 388, 1541, 9105, 458, 453, 4155, 385, 4320, 1368, 2420, 448, 121, 146, 26228, 7037, 452, 6095, 10596, 7433, 532, 22538, 938, 736, 388, 1541, 9105, 463, 459, 5013, 1478, 458, 6771, 1159, 8193, 5552, 391, 27613, 7764, 1368, 6986, 418, 16691, 461, 119, 133, 3355, 15748, 26228, 7037, 452, 25341, 18461, 458, 34721, 14312, 1368, 2377, 633, 4108, 12235, 458, 614, 4155, 385, 4320, 1368, 614, 4473, 5013, 1478, 458, 6771, 1159, 6316, 480, 8193, 5552, 938, 42542, 422, 7764, 938, 27613, 7764, 938, 35439, 321, 439, 6353, 938, 20156, 179, 359, 1368, 6047, 11808, 7367, 21745, 418, 122, 145, 7660, 12270, 10249, 8587, 430, 1734, 1731, 391, 3635, 28926, 458, 463, 4155, 385, 4320, 1368, 1182, 363, 818, 6870, 10549, 541, 12297, 938, 441, 474, 12427, 517, 363, 572, 114, 151, 114, 5508, 412, 9520, 633, 20580, 13529, 480, 8771, 2372, 6353, 1575, 363, 7123, 321, 439, 7941, 8272, 865, 871, 1382, 651, 688, 388, 3148, 4336, 430, 2034, 938, 576, 474, 508, 1966, 14020, 865, 484, 12980, 938, 9344, 790, 4603, 30552, 7605, 114, 391, 7313, 13757, 547, 938, 2199, 358, 2597, 865, 988, 21687, 17438, 2882, 418, 114, 14987, 938, 358, 8409, 8787, 3919, 480, 363, 44823, 34838, 37228, 3438, 938, 25852, 441, 474, 363, 7631, 10426, 387, 2338, 448, 633, 1697, 26228, 523, 3543, 865, 484, 5061, 13117, 648, 13986, 523, 358, 4672, 946, 2070, 458, 792, 358, 1279, 7471, 3681, 1368, 385, 363, 26228, 938, 391, 1082, 363, 12980, 651, 1340, 1876, 358, 10079, 456, 1689, 420, 13529, 938, 585, 24108, 385, 1661, 14987, 387, 764, 2647, 865, 14987, 938, 430, 2425, 3941, 938, 815, 508, 1661, 363, 12980, 387, 363, 2338, 448, 633, 1697, 183, 427, 648, 2334, 458, 873, 1097, 441, 474, 6869, 2001, 1368, 865, 1182, 363, 818, 6870, 13117, 10549, 541, 12297, 938, 585, 13057, 391, 2924, 967, 1912, 572, 114, 151, 114, 6316, 865, 1730, 1652, 631, 387, 878, 5344, 377, 358, 6555, 44338, 8435, 6610, 865, 3920, 14702, 523, 8038, 673, 363, 25552, 10485, 648, 1092, 953, 13787, 494, 21960, 12742, 719, 363, 9375, 13117, 2641, 13572, 391, 3635, 28926, 865, 16034, 938, 441, 419, 508, 1699, 698, 14702, 662, 524, 651, 982, 1346, 873, 712, 585, 651, 688, 16274, 9481, 391, 982, 618, 19369, 865, 484, 2583, 363, 5061, 8894, 388, 363, 13417, 648, 7087, 363, 1077, 456, 480, 18583, 21247, 938, 1097, 46727, 651, 2149, 5294, 2351, 6610, 427, 363, 5061, 651, 1642, 7485, 18583, 21247, 865, 484, 1734, 7004, 387, 363, 1469, 2641, 480, 868, 1159, 4865, 358, 114, 177, 114, 29928, 3963, 458, 614, 1159, 1349, 358, 114, 177, 114, 3527, 908, 5061, 9098, 3963, 938, 456, 4131, 517, 8038, 387, 363, 610, 17406, 988, 1973, 1368, 938, 452, 363, 1469, 420, 20156, 179, 359, 865, 418, 2573, 387, 47668, 5061, 13117, 388, 835, 9914, 4352, 541, 12297, 865, 19155, 938, 8927, 39124, 26228, 3058, 363, 818, 6870, 938, 29541, 363, 818, 7289, 387, 6076, 385, 1469, 363, 850, 1694, 8038, 2045, 458, 363, 3445, 26414, 1368, 938, 1082, 15748, 26228, 7485, 572, 114, 151, 114, 1734, 12637, 2074, 541, 12297, 938, 3700, 452, 42542, 422, 7764, 938, 363, 4488, 938, 391, 27613, 7764, 938, 363, 1489, 572, 114, 151, 114, 5508, 3802, 12801, 10644, 2880, 865, 484, 28470, 13117, 388, 363, 1319, 6870, 7485, 363, 5508, 3802, 12801, 806, 7560, 1767, 7764, 1575, 20156, 179, 359, 420, 363, 2445, 1005, 1836, 387, 363, 7123, 938, 391, 8193, 5552, 865, 484, 792, 17890, 5572, 1726, 523, 358, 10190, 387, 451, 633, 4671, 23546, 938, 451, 633, 2420, 1911, 27322, 938, 391, 718, 412, 14630, 461, 13069, 1304, 15748, 26228, 523, 363, 12021, 15074, 865, 418, 6673, 670, 622, 26508, 480, 513, 10348, 2315, 938, 363, 3218, 387, 631, 387, 363, 4934, 3535, 420, 363, 3265, 385, 18583, 21247, 655, 363, 818, 6870, 1469, 938, 647, 3725, 387, 363, 16672, 633, 5294, 10561, 14312, 458, 453, 40862, 18461, 1368, 8429, 633, 30763, 12235, 5811, 2378, 612, 5393, 3445, 6821, 6771, 865, 1730, 1652, 835, 387, 984, 12235, 6366, 611, 420, 3029, 938, 1295, 38855, 979, 41557, 382, 656, 1771, 1951, 6304, 938, 391, 631, 474, 358, 389, 564, 865, 637, 22631, 387, 363, 16672, 7433, 532, 22538, 2378, 3445, 26414, 938, 391, 1541, 7433, 532, 22538, 2378, 685, 8038, 865, 6166, 15601, 572, 114, 151, 114, 8038, 43464, 385, 363, 5339, 387, 36403, 938, 12235, 31091, 938, 391, 29377, 938, 21651, 7346, 661, 633, 45421, 1551, 385, 6677, 456, 585, 5067, 385, 3712, 2365, 6238, 9086, 865, 458, 484, 5964, 3376, 938, 7660, 3802, 9614, 18583, 21247, 865, 871, 419, 508, 16108, 865, 10249, 938, 474, 2009, 523, 363, 10144, 387, 21090, 13506, 5031, 938, 363, 818, 4765, 29928, 3242, 385, 3132, 865, 1368, 484, 16456, 648, 946, 45203, 865, 41512, 1280, 16050, 648, 9071, 938, 6316, 19685, 8640, 22605, 385, 8640, 22605, 388, 363, 1381, 385, 3049, 32084, 938, 6642, 35373, 458, 4945, 387, 363, 8666, 321, 439, 743, 7660, 1321, 4454, 183, 938, 792, 358, 3961, 387, 764, 4673, 6642, 938, 391, 792, 1541, 387, 3362, 5508, 13692, 1493, 388, 2324, 1368, 865, 8046, 529, 1978, 8096, 3823, 938, 968, 1706, 2523, 8314, 7183, 6941, 1242, 363, 1469, 865, 2140, 12784, 5790, 12041, 1147, 429, 7605, 114, 938, 15601, 12188, 938, 22520, 363, 4175, 321, 439, 1986, 645, 27103, 6642, 391, 474, 15153, 10758, 938, 576, 3868, 385, 408, 420, 1382, 865, 19191, 114, 13454, 477, 114, 142, 114, 5759, 22520, 12188, 388, 363, 10755, 321, 439, 8990, 391, 1493, 708, 840, 936, 1667, 363, 4175, 474, 22905, 480, 961, 1159, 939, 358, 114, 177, 114, 1982, 387, 363, 11512, 21301, 938, 418, 2746, 5505, 938, 1493, 17816, 452, 792, 1541, 3891, 15601, 938, 578, 3241, 429, 6008, 938, 4945, 452, 618, 722, 358, 715, 321, 439, 5518, 7178, 2263, 774, 12329, 480, 5518, 430, 4671, 2351, 979, 708, 25872, 3919, 5358, 385, 752, 837, 15601, 865, 8700, 438, 813, 2148, 14126, 396, 938, 25872, 2789, 6126, 938, 3058, 566, 1551, 1667, 440, 474, 2106, 967, 517, 21542, 523, 358, 5295, 644, 2378, 11388, 938, 7042, 1951, 7949, 865, 5599, 6870, 11843, 484, 1319, 6128, 6870, 20055, 387, 28470, 13117, 1159, 7276, 448, 121, 47604, 938, 9874, 461, 119, 1823, 938, 391, 4671, 418, 122, 10229, 938, 22520, 517, 21687, 633, 13454, 412, 25297, 38102, 27725, 31799, 32377, 865, 6776, 13117, 4155, 385, 4320, 881, 387, 6377, 13257, 865, 871, 6870, 391, 764, 6771, 19970, 1159, 453, 402, 5013, 1478, 7276, 448, 121, 47604, 7037, 452, 25341, 18461, 458, 34721, 14312, 1368, 391, 21862, 18461, 458, 3227, 14312, 1368, 2377, 633, 4108, 12235, 2782, 448, 121, 47604, 1478, 6316, 391, 321, 7738, 25922, 420, 20156, 179, 359, 938, 8193, 5552, 938, 391, 2510, 1314, 6353, 2782, 448, 121, 47604, 1478, 321, 7738, 25922, 391, 6316, 420, 42542, 422, 7764, 463, 459, 5013, 458, 6771, 1159, 6316, 16752, 391, 4731, 21673, 1368, 8800, 461, 119, 1823, 7037, 452, 25341, 18461, 458, 34721, 14312, 1368, 2377, 633, 4108, 12235, 938, 388, 1541, 9105, 458, 614, 46948, 1368, 614, 4473, 5013, 1478, 458, 6771, 1159, 6316, 480, 8193, 5552, 938, 42542, 422, 7764, 938, 27613, 7764, 938, 35439, 321, 439, 6353, 938, 20156, 179, 359, 1368, 3540, 418, 122, 10229, 430, 3862, 391, 3635, 28926, 458, 453, 46948, 1368, 484, 1319, 6870, 474, 9187, 757, 1216, 2729, 865, 1982, 474, 23153, 385, 1469, 610, 290, 811, 321, 100, 179, 359, 938, 363, 1435, 18583, 21247, 1875, 865, 484, 4654, 9105, 5385, 480, 363, 1469, 1067, 2149, 11741, 523, 1912, 11779, 865, 1706, 18600, 391, 2566, 10617, 3064, 2532, 807, 441, 2641, 938, 363, 1469, 474, 726, 865, 5031, 7420, 391, 3725, 30097, 648, 3024, 938, 391, 321, 43248, 1955, 10758, 2263, 29318, 5896, 391, 1734, 3754, 458, 609, 648, 737, 387, 363, 5508, 1667, 363, 4896, 572, 114, 151, 114, 3802, 5322, 474, 7143, 388, 21810, 1368, 648, 3024, 391, 45070, 10758, 2263, 16104, 45434, 648, 3024, 391, 8745, 10758, 2263, 391, 8358, 10481, 648, 3024, 391, 3540, 10758, 865, 655, 2573, 938, 463, 112, 31653, 3500, 3825, 391, 453, 112, 23289, 648, 10758, 865, 513, 495, 7922, 8038, 648, 24891, 494, 1158, 358, 2934, 938, 1491, 2037, 3445, 26414, 865, 1540, 387, 363, 3500, 3024, 494, 10758, 1242, 363, 1469, 648, 1830, 113, 40070, 1288, 938, 1914, 363, 1210, 713, 474, 746, 1282, 387, 1276, 719, 363, 1469, 5192, 865, 23217, 8044, 1242, 363, 1469, 23217, 12188, 938, 420, 2147, 391, 967, 480, 363, 9664, 938, 9462, 385, 2767, 363, 25552, 979, 953, 14694, 408, 2418, 3327, 363, 1706, 30192, 938, 3117, 2164, 648, 2334, 385, 363, 11379, 387, 8044, 321, 439, 2752, 7194, 807, 441, 474, 2378, 517, 358, 9619, 1568, 633, 11212, 458, 33022, 8186, 1368, 7683, 865, 27612, 9795, 517, 358, 39124, 391, 420, 2147, 10472, 26414, 938, 12188, 7583, 385, 8521, 363, 25552, 865, 1476, 474, 8078, 517, 968, 5061, 26228, 456, 774, 1493, 840, 936, 391, 12706, 618, 7228, 523, 8747, 18461, 458, 17419, 14312, 1368, 12235, 938, 644, 2168, 2353, 12353, 865, 1476, 474, 14694, 408, 2418, 385, 3469, 12114, 363, 25552, 10485, 865, 23217, 2789, 6126, 474, 24891, 517, 2338, 7433, 532, 22538, 391, 835, 12235, 1242, 363, 1469, 3543, 474, 2378, 517, 835, 12235, 391, 835, 7433, 532, 22538, 865, 484, 5563, 1345, 524, 4131, 708, 45860, 938, 576, 648, 6250, 385, 6972, 4175, 756, 456, 585, 648, 8721, 1277, 430, 363, 29120, 865, 21561, 3157, 523, 8044, 391, 2789, 6126, 38749, 967, 420, 708, 938, 391, 2293, 1026, 363, 3175, 905, 4886, 722, 441, 474, 865, 484, 696, 12127, 2597, 4175, 10303, 474, 390, 45443, 5504, 517, 7433, 532, 22538, 865, 2789, 6126, 474, 2378, 517, 3699, 7433, 532, 22538, 938, 363, 14125, 24548, 1598, 708, 475, 41787, 865, 10534, 474, 2378, 517, 1541, 7433, 532, 22538, 938, 363, 1039, 835, 2130, 708, 11100, 8429, 938, 644, 4174, 708, 385, 1552, 7958, 865, 10870, 474, 2378, 517, 835, 387, 363, 11614, 1568, 10249, 19780, 938, 576, 6260, 4174, 2827, 2566, 865, 5001, 363, 5061, 17399, 420, 3445, 26414, 458, 363, 4488, 14992, 2045, 1368, 938, 585, 851, 508, 8957, 685, 6771, 865, 484, 1758, 35340, 43017, 474, 39124, 377, 938, 391, 363, 27603, 523, 363, 12076, 1552, 14083, 363, 19752, 6265, 29390, 541, 4844, 6182, 865, 5031, 11512, 21301, 388, 5995, 23524, 938, 428, 45062, 391, 21943, 2617, 648, 6673, 719, 12235, 41948, 612, 5353, 28874, 16050, 865, 484, 25344, 5353, 5079, 2147, 2263, 17549, 363, 5995, 23524, 388, 382, 3727, 385, 2008, 2147, 1026, 363, 9583, 3157, 4586, 938, 391, 1212, 648, 11645, 604, 865, 428, 45062, 18960, 523, 708, 986, 518, 7122, 391, 11787, 1129, 21943, 2617, 865, 484, 1758, 35340, 34621, 474, 390, 45443, 517, 358, 39124, 865, 484, 1758, 35340, 43397, 474, 9795, 938, 576, 6251, 388, 2240, 865, 484, 9286, 8938, 8117, 7858, 938, 7042, 1951, 7949, 8044, 938, 474, 7373, 9795, 391, 408, 2418, 865, 484, 5518, 14483, 15504, 19670, 848, 474, 736, 9795, 865, 484, 41157, 18294, 474, 11335, 9795, 719, 835, 12235, 41948, 708, 2752, 7194, 865, 871, 3376, 43498, 363, 818, 572, 114, 151, 114, 4175, 938, 621, 114, 5694, 385, 1699, 18583, 21247, 865, 458, 2452, 22376, 391, 13508, 8795, 1368, 458, 5841, 427, 529, 419, 388, 3381, 385, 1909, 7660, 1249, 6619, 1699, 5734, 10249, 391, 18208, 3698, 480, 4321, 9406, 363, 3381, 953, 2815, 1667, 621, 114, 5694, 651, 7776, 12640, 865, 1368, 3327, 363, 42723, 1706, 6316, 388, 13809, 938, 27879, 648, 6673, 391, 26523, 9795, 938, 20809, 387, 707, 420, 363, 2424, 865, 16800, 4945, 648, 1783, 3593, 385, 1112, 673, 385, 4505, 363, 2880, 865, 18188, 5508, 3802, 12801, 15083, 5358, 385, 752, 32827, 1242, 363, 1469, 391, 2338, 648, 18242, 452, 47377, 869, 480, 1652, 631, 5061, 6316, 1242, 363, 1469, 1159, 453, 402, 19191, 114, 10275, 438, 114, 5932, 938, 463, 459, 19191, 114, 14677, 438, 114, 46650, 938, 463, 459, 19191, 114, 23733, 438, 114, 8222, 938, 463, 459, 19191, 114, 4603, 412, 114, 41625, 938, 463, 459, 19191, 114, 5951, 471, 114, 4474, 938, 391, 463, 459, 19191, 114, 11747, 468, 114, 23748, 7605, 865, 23748, 474, 2924, 967, 517, 19191, 114, 32772, 5451, 726, 20156, 179, 359, 4797, 391, 419, 5711, 456, 12391, 1993, 898, 32212, 458, 508, 25740, 655, 7662, 1368, 865, 19191, 114, 1858, 507, 114, 461, 1400, 474, 3024, 517, 8131, 2147, 8125, 523, 358, 5474, 726, 11712, 7010, 865, 3327, 4848, 451, 17614, 183, 388, 13809, 938, 2088, 648, 6673, 938, 391, 2338, 1955, 9795, 3776, 9286, 865, 458, 484, 1216, 420, 14070, 4605, 656, 11144, 1987, 865, 1368, 38784, 2147, 3282, 967, 718, 572, 114, 151, 114, 13117, 420, 1454, 387, 427, 938, 1491, 2037, 523, 382, 388, 7885, 5575, 523, 15074, 865, 5061, 3535, 420, 37759, 3024, 3325, 8314, 865, 1730, 363, 741, 387, 363, 1469, 938, 5294, 11208, 6316, 648, 7449, 388, 363, 26081, 387, 18583, 21247, 865, 3327, 878, 938, 1216, 648, 2924, 967, 865, 5061, 9190, 35452, 633, 2037, 5061, 1734, 3754, 391, 5294, 18350, 21358, 648, 3024, 388, 363, 1469, 938, 391, 631, 474, 8008, 865, 3327, 2970, 321, 439, 46001, 1796, 13117, 938, 2909, 648, 2727, 1242, 363, 3445, 458, 5294, 388, 363, 818, 1469, 6870, 938, 1261, 388, 363, 1319, 1368, 938, 452, 1295, 9016, 9795, 517, 1986, 645, 27103, 2147, 523, 363, 2424, 865, 33772, 2469, 6870, 12269, 5061, 13531, 3891, 1491, 477, 895, 3856, 391, 503, 7539, 11744, 15297, 43813, 385, 3384, 604, 358, 2469, 5688, 388, 1603, 385, 4218, 456, 982, 387, 18583, 21247, 321, 439, 5353, 391, 39124, 6244, 938, 9363, 938, 391, 5995, 23524, 7392, 456, 1845, 865, 503, 7539, 938, 609, 651, 40766, 25929, 430, 33928, 13809, 807, 363, 1734, 1469, 938, 4863, 427, 1332, 382, 11897, 938, 1216, 9057, 648, 3407, 385, 15661, 363, 2880, 456, 982, 456, 1845, 865, 484, 37652, 387, 363, 685, 2037, 16752, 388, 363, 4977, 2801, 2199, 585, 648, 4785, 391, 3593, 385, 3384, 604, 358, 2469, 5688, 865, 12943, 21363, 524, 5321, 363, 8267, 387, 878, 15292, 7392, 662, 524, 42730, 363, 572, 114, 151, 114, 8312, 20102, 1391, 618, 6512, 722, 363, 3095, 387, 764, 3445, 26414, 865, 1103, 585, 651, 688, 21223, 604, 938, 7660, 2827, 458, 1706, 1368, 4661, 388, 363, 8312, 662, 524, 688, 34023, 430, 618, 722, 358, 715, 10249, 2263, 1965, 385, 24747, 27044, 471, 114, 27269, 4325, 938, 1669, 13454, 388, 6054, 387, 363, 8312, 20102, 938, 7660, 441, 662, 524, 20674, 363, 1276, 1295, 835, 913, 865, 10249, 15297, 43813, 938, 2259, 938, 3167, 385, 8500, 430, 1912, 3941, 1159, 1706, 3199, 113, 165, 27103, 2955, 651, 6697, 15495, 1242, 363, 1319, 5688, 938, 391, 835, 41289, 387, 2970, 321, 439, 9190, 648, 23537, 1242, 363, 1319, 6870, 865, 15297, 43813, 3037, 712, 440, 5712, 358, 2469, 5688, 938, 440, 662, 408, 37335, 1216, 13721, 387, 363, 32129, 20102, 321, 439, 4303, 385, 20017, 604, 363, 5738, 6771, 458, 644, 3118, 363, 7392, 1368, 1082, 7296, 2541, 6316, 9190, 865, 484, 4168, 387, 363, 1706, 16752, 6251, 6540, 865, 655, 3191, 938, 363, 6279, 21194, 474, 5314, 566, 2801, 474, 884, 1727, 2938, 387, 1706, 2057, 633, 2013, 26228, 865, 15297, 43813, 474, 8728, 1872, 363, 572, 114, 151, 114, 651, 1677, 17098, 13117, 5738, 420, 13809, 385, 4320, 382, 1469, 1129, 566, 16752, 865, 418, 2469, 6870, 662, 524, 2773, 9005, 11925, 391, 34318, 741, 938, 391, 662, 524, 4102, 8125, 13117, 662, 524, 651, 385, 2057, 480, 1856, 865, 1730, 363, 741, 938, 792, 363, 8212, 8666, 651, 4267, 1856, 12021, 7706, 938, 624, 529, 474, 358, 9005, 2627, 865, 484, 4977, 2801, 321, 439, 5353, 3175, 851, 508, 8850, 784, 385, 3621, 388, 10251, 5194, 387, 18583, 21247, 982, 2493, 938, 1302, 440, 474, 480, 363, 946, 4280, 387, 41189, 1205, 865, 1776, 567, 624, 42280, 2592, 656, 13736, 1447, 1978, 420, 5353, 938, 3838, 873, 1820, 385, 6972, 11512, 21301, 652, 6440, 1464, 865, 780, 4863, 363, 1319, 5688, 651, 7087, 11479, 363, 1489, 9533, 387, 566, 4466, 1478, 363, 8601, 1735, 387, 363, 8312, 20102, 1478, 391, 851, 508, 4702, 385, 2627, 2353, 9190, 865, 11069, 938, 441, 474, 5061, 8666, 3458, 385, 4803, 363, 15004, 387, 4303, 726, 363, 2573, 8267, 387, 363, 4573, 865, 1730, 358, 4596, 15601, 566, 21437, 363, 1809, 3430, 938, 14164, 25485, 4956, 15297, 43813, 321, 439, 15321, 1332, 14026, 358, 2469, 6870, 865, 655, 23684, 938, 43211, 363, 9305, 23524, 33851, 938, 9363, 12538, 938, 391, 363, 3157, 6974, 5419, 4102, 363, 572, 114, 151, 114, 815, 3132, 5466, 3053, 385, 5061, 4669, 388, 363, 8312, 865, 14164, 25485, 1669, 44753, 15297, 43813, 321, 439, 2652, 385, 8500, 391, 4354, 26948, 5182, 441, 651, 688, 358, 1150, 7558, 508, 385, 1603, 358, 2469, 5688, 865, 34945, 2727, 494, 9795, 22482, 633, 631, 8038, 648, 9795, 494, 2727, 388, 363, 1469, 938, 387, 644, 578, 576, 1216, 648, 27558, 391, 4605, 385, 2240, 865, 5939, 26414, 8044, 458, 18027, 23228, 40245, 321, 439, 21437, 387, 5939, 6821, 7559, 1982, 1368, 1159, 2378, 517, 1541, 8429, 633, 30763, 12235, 938, 18851, 2263, 2573, 3095, 865, 453, 112, 22514, 2737, 865, 10534, 1159, 2378, 517, 2037, 7433, 532, 22538, 938, 1552, 14083, 2263, 2573, 3095, 865, 42414, 2737, 865, 2789, 6126, 1159, 2378, 517, 835, 12235, 938, 3699, 7433, 532, 22538, 938, 24891, 2263, 4605, 385, 2240, 3002, 17095, 865, 15797, 2737, 865, 3543, 1159, 2378, 517, 835, 12235, 938, 835, 7433, 532, 22538, 938, 24891, 2263, 4605, 385, 2240, 3370, 17095, 865, 1903, 2737, 865, 12188, 1159, 2378, 517, 2338, 12235, 938, 631, 39124, 938, 408, 2418, 2263, 4605, 385, 2240, 3368, 22559, 865, 3227, 2737, 865, 9690, 458, 418, 23228, 46653, 321, 439, 21437, 387, 363, 1679, 1930, 8312, 20102, 1368, 1159, 388, 1654, 5274, 836, 452, 428, 45062, 391, 21943, 2617, 938, 2378, 517, 631, 5295, 391, 16569, 523, 23217, 428, 45062, 2263, 6251, 388, 2240, 865, 961, 2737, 865, 11388, 1159, 2378, 517, 835, 12235, 2263, 4605, 385, 2240, 4046, 22559, 865, 743, 2737, 865, 10870, 1159, 2378, 517, 835, 12235, 2263, 4605, 385, 2240, 4046, 22559, 865, 705, 2737, 458, 1491, 12279, 14483, 8123, 2924, 967, 1368, 865, 1576, 113, 38572, 6821, 458, 2597, 1321, 321, 7353, 3148, 4175, 1368, 10303, 1159, 2378, 517, 835, 7433, 532, 22538, 938, 1552, 14083, 2263, 2573, 3095, 865, 5699, 2737, 865, 6573, 21673, 43017, 1159, 2378, 517, 631, 39124, 2263, 4605, 385, 2240, 3370, 22559, 865, 1261, 2737, 865, 34621, 1159, 2378, 517, 631], "start_token": -100, "end_token": -100, "category": 0}
|
{"path": "taser/train/akuapem/taser_1_0_dataset/taser_1_0_0000000000002.mp3", "sentence": "Kenan, Mahalalel, Yared, ", "start_time": "00:00:14.40000000", "start_time_ms": 14400, "end_time_ms": 17802.0, "duration": 3402.0, "gender": "male", "age": "thirties", "accent": "akuapem", "thumbsup": 3, "thumbsdown": 0}
|
{"path": "taser/train/akuapem/taser_1_0_dataset/taser_1_0_0000000000003.mp3", "sentence": "Henok, Metusela, Lamek, ", "start_time": "00:00:17.80254167", "start_time_ms": 17802, "end_time_ms": 21176.0, "duration": 3374.0, "gender": "male", "age": "thirties", "accent": "akuapem", "thumbsup": 3, "thumbsdown": 0}
|
{"path": "taser/train/akuapem/taser_1_0_dataset/taser_1_0_0000000000004.mp3", "sentence": "Noa mma ne, Sem, Ham, ne Yafet. ", "start_time": "00:00:21.17614583", "start_time_ms": 21176, "end_time_ms": 28451.0, "duration": 7275.0, "gender": "male", "age": "thirties", "accent": "akuapem", "thumbsup": 3, "thumbsdown": 0}
|
{"path": "taser/train/akuapem/taser_1_0_dataset/taser_1_0_0000000000005.mp3", "sentence": "Na Yafet asefo ne Gomer, Magog, Media, Yawan, Tubal, Mesek ne Tiras. ", "start_time": "00:00:28.45191667", "start_time_ms": 28451, "end_time_ms": 37400.0, "duration": 8949.0, "gender": "male", "age": "thirties", "accent": "akuapem", "thumbsup": 3, "thumbsdown": 0}
|
{"path": "taser/train/akuapem/taser_1_0_dataset/taser_1_0_0000000000006.mp3", "sentence": "Na Gomer asefo ne Askenas, Rifat ne Togarma. ", "start_time": "00:00:37.40000000", "start_time_ms": 37400, "end_time_ms": 41365.0, "duration": 3965.0, "gender": "male", "age": "thirties", "accent": "akuapem", "thumbsup": 3, "thumbsdown": 0}
|
{"path": "taser/train/akuapem/taser_1_0_dataset/taser_1_0_0000000000007.mp3", "sentence": "Na Yawan asefo ne Elisa, Tarsis, Kitim ne Rodanim. ", "start_time": "00:00:41.36512500", "start_time_ms": 41365, "end_time_ms": 49500.0, "duration": 8135.0, "gender": "male", "age": "thirties", "accent": "akuapem", "thumbsup": 3, "thumbsdown": 0}
|
{"path": "taser/train/akuapem/taser_1_0_dataset/taser_1_0_0000000000008.mp3", "sentence": "Na Ham asefo ne Kus, Misraim, Put ne Kanaan. ", "start_time": "00:00:49.50000000", "start_time_ms": 49500, "end_time_ms": 54519.0, "duration": 5019.0, "gender": "male", "age": "thirties", "accent": "akuapem", "thumbsup": 3, "thumbsdown": 0}
|
{"id": 0, "text": "I was wondering if anyone out there could enlighten me on this car I saw\nthe other day. It was a 2-door sports car, looked to be from the late 60s/\nearly 70s. It was called a Bricklin. The doors were really small. In addition,\nthe front bumper was separate from the rest of the body. This is \nall I know. If anyone can tellme a model name, engine specs, years\nof production, where this car is made, history, or whatever info you\nhave on this funky looking car, please e-mail.", "label": "rec.autos"}
|
{"id": 1, "text": "A fair number of brave souls who upgraded their SI clock oscillator have\nshared their experiences for this poll. Please send a brief message detailing\nyour experiences with the procedure. Top speed attained, CPU rated speed,\nadd on cards and adapters, heat sinks, hour of usage per day, floppy disk\nfunctionality with 800 and 1.4 m floppies are especially requested.\n\nI will be summarizing in the next two days, so please add to the network\nknowledge base if you have done the clock upgrade and haven't answered this\npoll. Thanks.", "label": "comp.sys.mac.hardware"}
|
{"id": 2, "text": "well folks, my mac plus finally gave up the ghost this weekend after\nstarting life as a 512k way back in 1985. sooo, i'm in the market for a\nnew machine a bit sooner than i intended to be...\n\ni'm looking into picking up a powerbook 160 or maybe 180 and have a bunch\nof questions that (hopefully) somebody can answer:\n\n* does anybody know any dirt on when the next round of powerbook\nintroductions are expected? i'd heard the 185c was supposed to make an\nappearence \"this summer\" but haven't heard anymore on it - and since i\ndon't have access to macleak, i was wondering if anybody out there had\nmore info...\n\n* has anybody heard rumors about price drops to the powerbook line like the\nones the duo's just went through recently?\n\n* what's the impression of the display on the 180? i could probably swing\na 180 if i got the 80Mb disk rather than the 120, but i don't really have\na feel for how much \"better\" the display is (yea, it looks great in the\nstore, but is that all \"wow\" or is it really that good?). could i solicit\nsome opinions of people who use the 160 and 180 day-to-day on if its worth\ntaking the disk size and money hit to get the active display? (i realize\nthis is a real subjective question, but i've only played around with the\nmachines in a computer store breifly and figured the opinions of somebody\nwho actually uses the machine daily might prove helpful).\n\n* how well does hellcats perform? ;)\n\nthanks a bunch in advance for any info - if you could email, i'll post a\nsummary (news reading time is at a premium with finals just around the\ncorner... :( )\n--\nTom Willis \\ twillis@ecn.purdue.edu \\ Purdue Electrical Engineering", "label": "comp.sys.mac.hardware"}
|
{"id": 3, "text": "\nDo you have Weitek's address/phone number? I'd like to get some information\nabout this chip.\n", "label": "comp.graphics"}
|
{"id": 4, "text": "From article <C5owCB.n3p@world.std.com>, by tombaker@world.std.com (Tom A Baker):\n\n\nMy understanding is that the 'expected errors' are basically\nknown bugs in the warning system software - things are checked\nthat don't have the right values in yet because they aren't\nset till after launch, and suchlike. Rather than fix the code\nand possibly introduce new bugs, they just tell the crew\n'ok, if you see a warning no. 213 before liftoff, ignore it'.", "label": "sci.space"}
|
{"id": 5, "text": "\n\n\n\n\nOf course. The term must be rigidly defined in any bill.\n\n\nI doubt she uses this term for that. You are using a quote allegedly\nfrom her, can you back it up?\n\n\n\n\nI read the article as presenting first an argument about weapons of mass\ndestruction (as commonly understood) and then switching to other topics.\nThe first point evidently was to show that not all weapons should be\nallowed, and then the later analysis was, given this understanding, to\nconsider another class.\n\n\n\n", "label": "talk.politics.guns"}
|
{"id": 6, "text": "There were a few people who responded to my request for info on\ntreatment for astrocytomas through email, whom I couldn't thank\ndirectly because of mail-bouncing probs (Sean, Debra, and Sharon). So\nI thought I'd publicly thank everyone.\n\nThanks! \n\n(I'm sure glad I accidentally hit \"rn\" instead of \"rm\" when I was\ntrying to delete a file last September. \"Hmmm... 'News?' What's\nthis?\"....)", "label": "sci.med"}
|
{"id": 7, "text": " \nALL this shows is that YOU don't know much about SCSI.\n\nSCSI-1 {with a SCSI-1 controler chip} range is indeed 0-5MB/s\nand that is ALL you have right about SCSI\nSCSI-1 {With a SCSI-2 controller chip}: 4-6MB/s with 10MB/s burst {8-bit}\n Note the INCREASE in SPEED, the Mac Quadra uses this version of SCSI-1\n so it DOES exist. Some PC use this set up too.\nSCSI-2 {8-bit/SCSI-1 mode}: 4-6MB/s with 10MB/s burst\nSCSI-2 {16-bit/wide or fast mode}: 8-12MB/s with 20MB/s burst\nSCSI-2 {32-bit/wide AND fast}: 15-20MB/s with 40MB/s burst\n \nBy your OWN data the \"Although SCSI is twice as fast as ESDI\" is correct\nWith a SCSI-2 controller chip SCSI-1 can reach 10MB/s which is indeed\n\"20% faster than IDE\" {120% of 8.3 is 9.96}. ALL these SCSI facts have been\nposted to this newsgroup in my Mac & IBM info sheet {available by FTP on \nsumex-aim.stanford.edu (36.44.0.6) in the info-mac/report as \nmac-ibm-compare[version #].txt (It should be 173 but 161 may still be there)}\n\nPart of this problem is both Mac and IBM PC are inconsiant about what SCSI\nis which. Though it is WELL documented that the Quadra has a SCSI-2 chip\nan Apple salesperson said \"it uses a fast SCSI-1 chip\" {Not at a 6MB/s,\n10MB/s burst it does not. SCSI-1 is 5MB/s maximum synchronous and Quadra\nuses ANsynchronous SCSI which is SLOWER} It seems that Mac and IBM see\nSCSI-1 interface and think 'SCSI-1' when it maybe a SCSI-1 interface driven\nin the machine by a SCSi-2 controller chip in 8-bit mode {Which is MUCH\nFASTER then true SCSI-1 can go}.", "label": "comp.sys.ibm.pc.hardware"}
|
{"id": 8, "text": "I have win 3.0 and downloaded several icons and BMP's but I can't figure out\nhow to change the \"wallpaper\" or use the icons. Any help would be appreciated.\n\n\nThanx,\n\n-Brando", "label": "comp.os.ms-windows.misc"}
|
{"id": 9, "text": "\n\n\nI've had the board for over a year, and it does work with Diskdoubler,\nbut not with Autodoubler, due to a licensing problem with Stac Technologies,\nthe owners of the board's compression technology. (I'm writing this\nfrom memory; I've lost the reference. Please correct me if I'm wrong.)\n\nUsing the board, I've had problems with file icons being lost, but it's\nhard to say whether it's the board's fault or something else; however,\nif I decompress the troubled file and recompress it without the board,\nthe icon usually reappears. Because of the above mentioned licensing\nproblem, the freeware expansion utility DD Expand will not decompress\na board-compressed file unless you have the board installed.\n\nSince Stac has its own product now, it seems unlikely that the holes\nin Autodoubler/Diskdoubler related to the board will be fixed.\nWhich is sad, and makes me very reluctant to buy Stac's product since\nthey're being so stinky. (But hey, that's competition.)\n-- ", "label": "comp.sys.mac.hardware"}
|
{"question_id": 41067960, "intent": "How to convert a list of multiple integers into a single integer?", "rewritten_intent": "Concatenate elements of a list 'x' of multiple integers to a single integer", "snippet": "sum(d * 10 ** i for i, d in enumerate(x[::-1]))"}
|
{"question_id": 41067960, "intent": "How to convert a list of multiple integers into a single integer?", "rewritten_intent": "convert a list of integers into a single integer", "snippet": "r = int(''.join(map(str, x)))"}
|
{"question_id": 4170655, "intent": "how to convert a datetime string back to datetime object?", "rewritten_intent": "convert a DateTime string back to a DateTime object of format '%Y-%m-%d %H:%M:%S.%f'", "snippet": "datetime.strptime('2010-11-13 10:33:54.227806', '%Y-%m-%d %H:%M:%S.%f')"}
|
{"question_id": 29565452, "intent": "Averaging the values in a dictionary based on the key", "rewritten_intent": "get the average of a list values for each key in dictionary `d`)", "snippet": "[(i, sum(j) / len(j)) for i, j in list(d.items())]"}
|
{"question_id": 13704860, "intent": "zip lists in python", "rewritten_intent": "zip two lists `[1, 2]` and `[3, 4]` into a list of two tuples containing elements at the same index in each list", "snippet": "zip([1, 2], [3, 4])"}
|
{"question_id": 13331419, "intent": "Prepend the same string to all items in a list", "rewritten_intent": "prepend string 'hello' to all items in list 'a'", "snippet": "['hello{0}'.format(i) for i in a]"}
|
{"question_id": 25474338, "intent": "regex for repeating words in a string in Python", "rewritten_intent": "regex for repeating words in a string `s`", "snippet": "re.sub('(?<!\\\\S)((\\\\S+)(?:\\\\s+\\\\2))(?:\\\\s+\\\\2)+(?!\\\\S)', '\\\\1', s)"}
|
{"question_id": 18594469, "intent": "Normalizing a pandas DataFrame by row", "rewritten_intent": "normalize a pandas dataframe `df` by row", "snippet": "df.div(df.sum(axis=1), axis=0)"}
|
{"question_id": 13384841, "intent": "swap values in a tuple/list inside a list in python?", "rewritten_intent": "Swap values in a tuple/list in list `mylist`", "snippet": "[(t[1], t[0]) for t in mylist]"}
|
{"id": "0704.0001", "submitter": "Pavel Nadolsky", "authors": "C. Bal\\'azs, E. L. Berger, P. M. Nadolsky, C.-P. Yuan", "title": "Calculation of prompt diphoton production cross sections at Tevatron and\n LHC energies", "comments": "37 pages, 15 figures; published version", "journal-ref": "Phys.Rev.D76:013009,2007", "doi": "10.1103/PhysRevD.76.013009", "abstract": " A fully differential calculation in perturbative quantum chromodynamics is\npresented for the production of massive photon pairs at hadron colliders. All\nnext-to-leading order perturbative contributions from quark-antiquark,\ngluon-(anti)quark, and gluon-gluon subprocesses are included, as well as\nall-orders resummation of initial-state gluon radiation valid at\nnext-to-next-to-leading logarithmic accuracy. The region of phase space is\nspecified in which the calculation is most reliable. Good agreement is\ndemonstrated with data from the Fermilab Tevatron, and predictions are made for\nmore detailed tests with CDF and DO data. Predictions are shown for\ndistributions of diphoton pairs produced at the energy of the Large Hadron\nCollider (LHC). Distributions of the diphoton pairs from the decay of a Higgs\nboson are contrasted with those produced from QCD processes at the LHC, showing\nthat enhanced sensitivity to the signal can be obtained with judicious\nselection of events.\n", "report-no": "ANL-HEP-PR-07-12", "categories": ["hep-ph"], "versions": ["v1", "v2"]}
|
{"id": "0704.0002", "submitter": "Louis Theran", "authors": "Ileana Streinu and Louis Theran", "title": "Sparsity-certifying Graph Decompositions", "comments": "To appear in Graphs and Combinatorics", "journal-ref": null, "doi": null, "abstract": " We describe a new algorithm, the $(k,\\ell)$-pebble game with colors, and use\nit obtain a characterization of the family of $(k,\\ell)$-sparse graphs and\nalgorithmic solutions to a family of problems concerning tree decompositions of\ngraphs. Special instances of sparse graphs appear in rigidity theory and have\nreceived increased attention in recent years. In particular, our colored\npebbles generalize and strengthen the previous results of Lee and Streinu and\ngive a new proof of the Tutte-Nash-Williams characterization of arboricity. We\nalso present a new decomposition that certifies sparsity based on the\n$(k,\\ell)$-pebble game with colors. Our work also exposes connections between\npebble game algorithms and previous sparse graph algorithms by Gabow, Gabow and\nWestermann and Hendrickson.\n", "report-no": null, "categories": ["math.CO cs.CG"], "versions": ["v1", "v2"]}
|
{"id": "0704.0003", "submitter": "Hongjun Pan", "authors": "Hongjun Pan", "title": "The evolution of the Earth-Moon system based on the dark matter field\n fluid model", "comments": "23 pages, 3 figures", "journal-ref": null, "doi": null, "abstract": " The evolution of Earth-Moon system is described by the dark matter field\nfluid model proposed in the Meeting of Division of Particle and Field 2004,\nAmerican Physical Society. The current behavior of the Earth-Moon system agrees\nwith this model very well and the general pattern of the evolution of the\nMoon-Earth system described by this model agrees with geological and fossil\nevidence. The closest distance of the Moon to Earth was about 259000 km at 4.5\nbillion years ago, which is far beyond the Roche's limit. The result suggests\nthat the tidal friction may not be the primary cause for the evolution of the\nEarth-Moon system. The average dark matter field fluid constant derived from\nEarth-Moon system data is 4.39 x 10^(-22) s^(-1)m^(-1). This model predicts\nthat the Mars's rotation is also slowing with the angular acceleration rate\nabout -4.38 x 10^(-22) rad s^(-2).\n", "report-no": null, "categories": ["physics.gen-ph"], "versions": ["v1", "v2", "v3"]}
|
{"id": "0704.0004", "submitter": "David Callan", "authors": "David Callan", "title": "A determinant of Stirling cycle numbers counts unlabeled acyclic\n single-source automata", "comments": "11 pages", "journal-ref": null, "doi": null, "abstract": " We show that a determinant of Stirling cycle numbers counts unlabeled acyclic\nsingle-source automata. The proof involves a bijection from these automata to\ncertain marked lattice paths and a sign-reversing involution to evaluate the\ndeterminant.\n", "report-no": null, "categories": ["math.CO"], "versions": ["v1"]}
|
{"id": "0704.0005", "submitter": "Alberto Torchinsky", "authors": "Wael Abu-Shammala and Alberto Torchinsky", "title": "From dyadic $\\Lambda_{\\alpha}$ to $\\Lambda_{\\alpha}$", "comments": null, "journal-ref": "Illinois J. Math. 52 (2008) no.2, 681-689", "doi": null, "abstract": " In this paper we show how to compute the $\\Lambda_{\\alpha}$ norm, $\\alpha\\ge\n0$, using the dyadic grid. This result is a consequence of the description of\nthe Hardy spaces $H^p(R^N)$ in terms of dyadic and special atoms.\n", "report-no": null, "categories": ["math.CA math.FA"], "versions": ["v1"]}
|
{"id": "0704.0006", "submitter": "Yue Hin Pong", "authors": "Y. H. Pong and C. K. Law", "title": "Bosonic characters of atomic Cooper pairs across resonance", "comments": "6 pages, 4 figures, accepted by PRA", "journal-ref": null, "doi": "10.1103/PhysRevA.75.043613", "abstract": " We study the two-particle wave function of paired atoms in a Fermi gas with\ntunable interaction strengths controlled by Feshbach resonance. The Cooper pair\nwave function is examined for its bosonic characters, which is quantified by\nthe correction of Bose enhancement factor associated with the creation and\nannihilation composite particle operators. An example is given for a\nthree-dimensional uniform gas. Two definitions of Cooper pair wave function are\nexamined. One of which is chosen to reflect the off-diagonal long range order\n(ODLRO). Another one corresponds to a pair projection of a BCS state. On the\nside with negative scattering length, we found that paired atoms described by\nODLRO are more bosonic than the pair projected definition. It is also found\nthat at $(k_F a)^{-1} \\ge 1$, both definitions give similar results, where more\nthan 90% of the atoms occupy the corresponding molecular condensates.\n", "report-no": null, "categories": ["cond-mat.mes-hall"], "versions": ["v1"]}
|
{"id": "0704.0007", "submitter": "Alejandro Corichi", "authors": "Alejandro Corichi, Tatjana Vukasinac and Jose A. Zapata", "title": "Polymer Quantum Mechanics and its Continuum Limit", "comments": "16 pages, no figures. Typos corrected to match published version", "journal-ref": "Phys.Rev.D76:044016,2007", "doi": "10.1103/PhysRevD.76.044016", "abstract": " A rather non-standard quantum representation of the canonical commutation\nrelations of quantum mechanics systems, known as the polymer representation has\ngained some attention in recent years, due to its possible relation with Planck\nscale physics. In particular, this approach has been followed in a symmetric\nsector of loop quantum gravity known as loop quantum cosmology. Here we explore\ndifferent aspects of the relation between the ordinary Schroedinger theory and\nthe polymer description. The paper has two parts. In the first one, we derive\nthe polymer quantum mechanics starting from the ordinary Schroedinger theory\nand show that the polymer description arises as an appropriate limit. In the\nsecond part we consider the continuum limit of this theory, namely, the reverse\nprocess in which one starts from the discrete theory and tries to recover back\nthe ordinary Schroedinger quantum mechanics. We consider several examples of\ninterest, including the harmonic oscillator, the free particle and a simple\ncosmological model.\n", "report-no": "IGPG-07/03-2", "categories": ["gr-qc"], "versions": ["v1", "v2"]}
|
{"id": "0704.0008", "submitter": "Damian Swift", "authors": "Damian C. Swift", "title": "Numerical solution of shock and ramp compression for general material\n properties", "comments": "Minor corrections", "journal-ref": "Journal of Applied Physics, vol 104, 073536 (2008)", "doi": "10.1063/1.2975338", "abstract": " A general formulation was developed to represent material models for\napplications in dynamic loading. Numerical methods were devised to calculate\nresponse to shock and ramp compression, and ramp decompression, generalizing\nprevious solutions for scalar equations of state. The numerical methods were\nfound to be flexible and robust, and matched analytic results to a high\naccuracy. The basic ramp and shock solution methods were coupled to solve for\ncomposite deformation paths, such as shock-induced impacts, and shock\ninteractions with a planar interface between different materials. These\ncalculations capture much of the physics of typical material dynamics\nexperiments, without requiring spatially-resolving simulations. Example\ncalculations were made of loading histories in metals, illustrating the effects\nof plastic work on the temperatures induced in quasi-isentropic and\nshock-release experiments, and the effect of a phase transition.\n", "report-no": "LA-UR-07-2051, LLNL-JRNL-410358", "categories": ["cond-mat.mtrl-sci"], "versions": ["v1", "v2", "v3"]}
|
{"id": "0704.0009", "submitter": "Paul Harvey", "authors": "Paul Harvey, Bruno Merin, Tracy L. Huard, Luisa M. Rebull, Nicholas\n Chapman, Neal J. Evans II, Philip C. Myers", "title": "The Spitzer c2d Survey of Large, Nearby, Insterstellar Clouds. IX. The\n Serpens YSO Population As Observed With IRAC and MIPS", "comments": null, "journal-ref": "Astrophys.J.663:1149-1173,2007", "doi": "10.1086/518646", "abstract": " We discuss the results from the combined IRAC and MIPS c2d Spitzer Legacy\nobservations of the Serpens star-forming region. In particular we present a set\nof criteria for isolating bona fide young stellar objects, YSO's, from the\nextensive background contamination by extra-galactic objects. We then discuss\nthe properties of the resulting high confidence set of YSO's. We find 235 such\nobjects in the 0.85 deg^2 field that was covered with both IRAC and MIPS. An\nadditional set of 51 lower confidence YSO's outside this area is identified\nfrom the MIPS data combined with 2MASS photometry. We describe two sets of\nresults, color-color diagrams to compare our observed source properties with\nthose of theoretical models for star/disk/envelope systems and our own modeling\nof the subset of our objects that appear to be star+disks. These objects\nexhibit a very wide range of disk properties, from many that can be fit with\nactively accreting disks to some with both passive disks and even possibly\ndebris disks. We find that the luminosity function of YSO's in Serpens extends\ndown to at least a few x .001 Lsun or lower for an assumed distance of 260 pc.\nThe lower limit may be set by our inability to distinguish YSO's from\nextra-galactic sources more than by the lack of YSO's at very low luminosities.\nA spatial clustering analysis shows that the nominally less-evolved YSO's are\nmore highly clustered than the later stages and that the background\nextra-galactic population can be fit by the same two-point correlation function\nas seen in other extra-galactic studies. We also present a table of matches\nbetween several previous infrared and X-ray studies of the Serpens YSO\npopulation and our Spitzer data set.\n", "report-no": null, "categories": ["astro-ph"], "versions": ["v1"]}
|
{"id": "0704.0010", "submitter": "Sergei Ovchinnikov", "authors": "Sergei Ovchinnikov", "title": "Partial cubes: structures, characterizations, and constructions", "comments": "36 pages, 17 figures", "journal-ref": null, "doi": null, "abstract": " Partial cubes are isometric subgraphs of hypercubes. Structures on a graph\ndefined by means of semicubes, and Djokovi\\'{c}'s and Winkler's relations play\nan important role in the theory of partial cubes. These structures are employed\nin the paper to characterize bipartite graphs and partial cubes of arbitrary\ndimension. New characterizations are established and new proofs of some known\nresults are given.\n The operations of Cartesian product and pasting, and expansion and\ncontraction processes are utilized in the paper to construct new partial cubes\nfrom old ones. In particular, the isometric and lattice dimensions of finite\npartial cubes obtained by means of these operations are calculated.\n", "report-no": null, "categories": ["math.CO"], "versions": ["v1"]}
|
{"Unnamed: 0": 4, "Sentences": " gali gali mein shor hai gaaanjaaaa shair chor hai ", "Labels": "neg"}
|
{"q_id": "32wvn8", "title": "what's the difference between a forest and a wood?", "selftext": "", "document": "", "subreddit": "explainlikeimfive", "url": "http://www.reddit.com/r/explainlikeimfive/comments/32wvn8/eli5_whats_the_difference_between_a_forest_and_a/", "answers": {"a_id": ["cqfd1d8"], "score": [2], "text": ["They're used interchangeably a lot. You'll get different answers from different resources, but the general consensus seems to be that woods are smaller than forests.\n\n > A wood is an area covered in trees, larger than a grove or a copse. A forest is also an area covered in trees, but it is larger than a wood\n\n > The U.S. National Vegetation Classification system differentiates them according to their densities: 25 to 60 percent of a a wood is covered by tree canopies, while 60 to 100 percent of a forest is canopied."]}, "title_urls": [], "selftext_urls": [], "answers_urls": [[]]}
|
{"q_id": "elzx1n", "title": "we do we instinctively grab a part of our body after it is hurt?", "selftext": "I just tweaked my wrist and my immediate reaction was to grasp it. I have no idea if grabbing it actually does anything, but it seems to be a natural reaction for most people when a body part hurts. Why is that?", "document": "", "subreddit": "explainlikeimfive", "url": "https://www.reddit.com/r/explainlikeimfive/comments/elzx1n/eli5_we_do_we_instinctively_grab_a_part_of_our/", "answers": {"a_id": ["fdlfvnn", "fdltn5j"], "score": [11, 3], "text": ["A) instinct. To protect it from further damage (if the damaging agent is ongoing) or to prevent bleeding and such.\n\nB) pain. Our brain knows that pressure sensation blocks pain sensation from experience. So we reflexively grab the injury site because it alleviates the pain.\n\nEdit: English and clarity", "So you have 2 different types of pressure sensors in your skin, superficial or closer to the surface and deep. Pressure sensors report back to the brain faster than pain sensors do so you can \"jam the signal\" ish by applying pressure. Say you put your hand on a hot burner, the spine has limited commands it can give to the body in case the brain can't give commands (see stroke victims) or to protect the body from further damage. This means that the pain signal follows tracks of nerve impulses to the spine where a quick response is sent back while a detailed report of the pain is sent to the sensory part of the brain for further analysis. The brain follows up the damage report by checking sensation, applying pressure or grabbing the area. Typically you also visually check it as well to see how the skin in the area is doing."]}, "title_urls": [], "selftext_urls": [], "answers_urls": [[], []]}
|
{"q_id": "3lv8jv", "title": "what causes \"flashing lights\", or blurry vision after strenuous physical activity?", "selftext": "Had this happen to my younger brother. My parents are convinced he has a concussion and are having him see multiple doctors and are preventing him from doing any physical activity until further notice, as well as most-likely inhibiting him from joining the wrestling team for his high school. I don't want this to happen.\n\nHe had no significant amount of water before an hour workout that included 10 minutes of jump roping followed by 50 minutes of lifting. \n\nMy brother claims to have seen flashing lights after he stood up from a 10 minute car ride home. \n", "document": "", "subreddit": "explainlikeimfive", "url": "https://www.reddit.com/r/explainlikeimfive/comments/3lv8jv/eli5_what_causes_flashing_lights_or_blurry_vision/", "answers": {"a_id": ["cv9l5or"], "score": [2], "text": ["**NOTE**: I am not a medical doctor, and this is not a diagnosis; just the best attempt I can at explaining it.\n\nIt's likely caused by the gel inside of his eyes rubbing on or pulling at the retina. If he stood up after a car ride, it can cause a change in blood pressure as well, which would lead to less oxygen going to the brain and some experience flashes of light along with a narrowing of the field of vision."]}, "title_urls": [], "selftext_urls": [], "answers_urls": [[]]}
|
{"q_id": "1rwxa7", "title": "if an ambulance on its way to a call witnesses an accident, what do they do?", "selftext": "", "document": "", "subreddit": "explainlikeimfive", "url": "http://www.reddit.com/r/explainlikeimfive/comments/1rwxa7/eli5_if_an_ambulance_on_its_way_to_a_call/", "answers": {"a_id": ["cdrqan1", "cdrqmb0"], "score": [9, 3], "text": ["It depends on the severity of the accident compared to the severity of the call they're en route to. If they see a horrible car wreck, and they're on a call for a broken bone, they'll stop for the wreck and radio in to let the dispatcher know to send out a new ambulance for the initial call. However, if they were on their way to a heart attack victim, they'll likely radio in and request a new ambulance for the wreck.", "Paramedic here.\n\nWe stop, have a short look and call dispatch. Ultimately, until we reach the patient it's their call so they set the priorities in such a situation."]}, "title_urls": [], "selftext_urls": [], "answers_urls": [[], []]}
|
{"q_id": "272ed8", "title": "how do i know that i don't have depth perception?", "selftext": "Could I lack depth perception and just not know it?", "document": "", "subreddit": "explainlikeimfive", "url": "http://www.reddit.com/r/explainlikeimfive/comments/272ed8/eli5_how_do_i_know_that_i_dont_have_depth/", "answers": {"a_id": ["chwv0xm"], "score": [2], "text": ["Sure, if you've never experienced true binocularity (brain fusing each eye's image into one that is 3D), you might not realize you don't have it. It's possible to develop that skill so long as both eyes are physically intact and functional and so is your brain. Neuroscience ftw!\n\n A book that discusses this is \"Stereo Sue\" by Sue Barry about a lady scientist who didn't realize that very thing she was in her 50s and was able to regain it. It's an interesting story! "]}, "title_urls": [], "selftext_urls": [], "answers_urls": [[]]}
|
{"q_id": "8oarq7", "title": "since oil & water don't mix, how are essential oil soaks helpful?", "selftext": "Doesn't the oil just sit on the surface, like it looks, reaching the intended body parts only in the small area that intersects with the top of the water? Or does it slowly mix with the water?", "document": "", "subreddit": "explainlikeimfive", "url": "https://www.reddit.com/r/explainlikeimfive/comments/8oarq7/eli5_since_oil_water_dont_mix_how_are_essential/", "answers": {"a_id": ["e01xr6g", "e01z28r"], "score": [11, 6], "text": ["As far as I know there is no scientific proof that essential oils work anyway, but yes your skin can only absorb so much.", "Essential oils are worthless for everything but smelling good anyway, so adding water certainly doesn't improve anything"]}, "title_urls": [], "selftext_urls": [], "answers_urls": [[], []]}
|
{"q_id": "75t27i", "title": "if a nuclear bomb is dropped on other nuclear bombs that are idle on the ground, will it create a double explosion or do these weapons need to become 'activated' in order for them to be able to detonate?", "selftext": "", "document": "", "subreddit": "explainlikeimfive", "url": "https://www.reddit.com/r/explainlikeimfive/comments/75t27i/eli5_if_a_nuclear_bomb_is_dropped_on_other/", "answers": {"a_id": ["do8pkru", "do8pkuz", "do8ps5a", "do8pyoe", "do8q57e", "do8ygs7"], "score": [2, 2, 2, 12, 7, 5], "text": ["a nuclear device functions by joining two or more chunks of radioactive material with explosive force together attaining a critical sustainable mass. A nuke dropped on nukes would not trigger this....the grounded nukes could only, theoretically, add to the radioactive fallout as their unspent nuclear material is scattered about \n\nPs your premise is a bit flawed as MOST nukes are detonated ABOVE a target, not on impact with it. ", "Nuclear bombs need to be set off in a controlled way in order to explode in the massive yield they normally would. However they contain conventional explosives which would certainly spread radioactive material around. But if you are setting them off with a nuke that won't be a big impact.", "In any design that's actually been built the nuclear bomb can't be detonated externally, they must be triggered through a very specific and carefully timed sequence of events.\n\nBombing them would just damage them and possibly scatter radioactive material.", "Depends on a lot of things.\n\nNuclear bombs work by changing the critical mass of the nuclear fuel. \"Critical mass\" is the amount of nuclear material you need to have a sustained nuclear reaction. You can artificially make a smaller-than-critical mass into a critical mass in several ways. One way is to cover it with a material that reflects neutrons (which would cause all the neutrons that would've escaped outwards from the material to reflect back inwards, generally used in nuclear reactors and research), but another way is to change the temperature and pressure of the material (which is done in nuclear weapons by using \"explosive lenses\" which is a fancy way of saying you surround it with conventional explosives).\n\nWithout those explosives going off (and a few other things I'd guess) that nuclear weapon isn't actually fissile (able to undergo fission). A nuclear explosion above the silo where the bombs are stored is just as likely to vaporize the exposive as anything else, not to mention that unless that explosion is able to actually trigger the explosive correctly it's not going to explode. (C4 and TNT for example are completely safe to burn, and only explode with specific stimulii.)\n\n", "Detonating a nuclear bomb is a very precise process, a lot of complicated things have to happen in just the right order. Even the most primitive bombs would be unlikely to go off in a high order explosion just because of a nearby explosion, nuclear or not. Modern nuclear weapons are actually deliberately designed so this is impossible, as a safety measure.", "Nuclear weapons are conceptually simple, you smash together enough U-235 (a 'supercritical mass') and it goes boom. The hard part is making it go boom when you want it to, and NOT melt when it's sitting in a silo.\n\nThere are two kinds of 'explosions' that occur in a nuclear weapon. The most obvious one is the nuclear fission chain reaction that makes a nuke what it is, which I'll call 'nuclear detonation'. The second kind of explosion (technically the first to happen) is what I'll call a 'primary detonation', which is a bunch of high explosives rigged precisely to trigger or 'ignite' the big boom.\n\nThere are two main ways in which these parts are put together, the 'Gun' and the 'implosion' methods. In the gun device, a big slug of U-235 is shot at high speed into another mass of U-235 that fits it like a glove, bringing together a supercritical mass. This device was constructed during the Manhattan Project by essentially strapping a bunch of expensive equipment and U-235 to an artillery piece and firing it. The second method uses a hollow sphere (also known as a pit) made of Uranium. In its hollow shape, the mass is not supercritical, but when it is compressed by the primary detonation into a solid ball, the mass becomes supercritical. It's a lot like crushing a soda can, but your hands are TNT and the soda can is going to blow your block party off the map.\n\nIn both methods of detonation, the critical mass must be brought together very quickly and very precisely. Otherwise, instead of the desired nuclear ignition, a 'premature detonation' will occur, severely reducing the weapon's power (loads better for the world than premature ejaculation ;). \n\nSo, to answer the question, if a nuclear warhead were dropped on a warehouse full of nukes, it would NOT cause nuclear detonations in the other weapons. It would, however, cause lots of bad shit, including:\n\n-Big Boom from the original warhead\n\n-All of the nuclear materials in the bombs is now volatile nuclear waste that may be in various states of criticality and may or may not fissioning and creating more hazardous waste. To get an idea of what this could develop into in the worst case scenario, read up on the elephant's foot at Chernobyl. Its not exactly the same situation, but Chernobyl gives us an idea of how difficult it is to move and protect ourselves from uncontained fission materials.\n\n-Detonation of high explosives from primary detonation systems of other bombs. This is unlikely to cause any nuclear detonations because the precision of the detonation is completely overwhelmed by the initial warhead, but explosives are explosives. TBH the size of these explosions is nothing compared to the initial weapon's power, and amounts to something like a mosquito bite on an arm that a bear just tore off of you.\n\n-WWIII (Assuming some head-ass didn't bomb their own country, which almost happened once in North Carolina I think)\n\n\nTL;DR: No, it won't cause a 'Double Explosion', but it's still a nuke, and it's gonna kill the heck out of you.\n\n\nSide note: For similar reasons, nuking or crashing a plane into a nuclear power plant does not cause a nuclear detonation. Nuclear weapons are devices carefully orchestrated and calibrated to 'make the stars align' so to speak, and create the very narrow conditions that make a nuclear explosion possible. On the other hand, a power plant is designed to generate electricity in a sustained and controlled fashion, which inherently precludes the possibility of a nuclear detonation, simply because the specifications on how to trigger a nuclear detonation are so tight."]}, "title_urls": [], "selftext_urls": [], "answers_urls": [[], [], [], [], [], []]}
|
{"q_id": "7wy34p", "title": "why do bottles of liquid have a dent/semi circle at the bottom of them?", "selftext": "My brother told me a while ago that it prevents it from exploding or something. Is there an act", "document": "", "subreddit": "explainlikeimfive", "url": "https://www.reddit.com/r/explainlikeimfive/comments/7wy34p/eli5_why_do_bottles_of_liquid_have_a_dentsemi/", "answers": {"a_id": ["du43702", "du44tut", "du45aky", "du47c2j", "du4c6z3"], "score": [31, 11, 9, 5, 3], "text": ["Its to make the plastic stronger. Without it they would have to add much more plastic to make it stable, which is more expensive. The bottle wouldn't explode, but it would cause the thinner areas to sag and deform. That would increase the chance of it bursting apart when force is applied. But with the divot, that sort of outcome is essentially impossible.", "It can be for strength, if the contents are under pressure, or it can just be so it will sit flat on a surface without rocking. You could in theory do that with a perfectly flat bottom, but that requires more precise and expensive molds(have to account for distortion as it cools too). Or it can be to make the bottle look bigger, compared to its volume. \n\n", "If you had a flat bottom it would simply bulge out. Now you would have a shitty bottle that can't stand. The dome simply distributes the forces evenly to the outside ring of the dome. It's the outside ring that has a bit more ridigity that prevents that from deforming.\n\nI suggest you look up the making and design of a soda can on YouTube. It explains the engineering behind it. Pretty cool stuff. ", "The dent and curved rim on the bottom of a can gives it the strength to be stacked on without bursting", "I can't speak much for glass bottles, but plastic bottles and aluminum cans have these features so that if they freeze, the plastic will bulge out and pop into a new position that gives the liquid more free volume to occupy. This prevents a sticky mess on the consumer's garage floor"]}, "title_urls": [], "selftext_urls": [], "answers_urls": [[], [], [], [], []]}
|
{"q_id": "5by6yg", "title": "the dow futures is reported to have dropped 700 points already. what does that mean for retirement funds, the market in general, etc...?", "selftext": "", "document": "", "subreddit": "explainlikeimfive", "url": "https://www.reddit.com/r/explainlikeimfive/comments/5by6yg/eli5_the_dow_futures_is_reported_to_have_dropped/", "answers": {"a_id": ["d9s743x", "d9s7rst", "d9scu9p"], "score": [4, 14, 2], "text": ["It means that Mr. Market is scared, and the future looks really bleak. \n\nThe market believes a recession or worse is coming and that for the foreseeable future, things in an economic sense look bad. \n\nRetirement funds are based heavily on the stock market (not entirely) which will go down correspondingly. However, they are also based to some degree on bonds, which generally go up when stocks go down. \n\nGenerally....\n\nThe thing is, no one really truly knows the answer. And if they did, they could use that knowledge to make money. \n\nWhat it means for you and for me is that most experts foresee bad things happening. ", "What u/Chumkil said but it is unlikely to be a long-lasting drop, the underlying economy is strong and, once the excitement has died down, the markets will return to their original state - i.e. rising.\n\nThe BBC were talking about this yesterday, apparently these flash-crashes are more to do with computer algorithm trading more than human sentiment. Their analyst's advice to investors was \"play the long game and sit tight, use any significant drop to expand your portfolio.\"", "What I don't understand is how the market is falling, when markets have been closed since 4:00pm EST and the first polls don't close until 7....I mean I can see how people will forecast the drop tonight, but wouldn't the market have to open in the morning to actually drop?"]}, "title_urls": [], "selftext_urls": [], "answers_urls": [[], [], []]}
|
{"Source": "it_events", "Event": "It is PersonY's favorite color", "Xintent": "[\"none\"]", "Xemotion": "[\"none\"]", "Otheremotion": "[\"happy\"]", "Xsent": null, "Osent": 4.0}
|
{"Source": "it_events", "Event": "It is PersonY's favorite color", "Xintent": "[\"none\"]", "Xemotion": "[\"none\"]", "Otheremotion": "[\"pleased\"]", "Xsent": null, "Osent": 4.0}
|
{"Source": "it_events", "Event": "It is PersonY's favorite color", "Xintent": "[\"none\"]", "Xemotion": "[\"none\"]", "Otheremotion": "[\"happy\", \"pleased\"]", "Xsent": null, "Osent": 5.0}
|
{"Source": "it_events", "Event": "It is a good thing", "Xintent": "[\"none\"]", "Xemotion": "[\"none\"]", "Otheremotion": "[\"happy\", \"satisfied\"]", "Xsent": null, "Osent": 5.0}
|
{"Source": "it_events", "Event": "It is a good thing", "Xintent": "[\"none\"]", "Xemotion": "[\"none\"]", "Otheremotion": "[\"happy\", \"thrilled\"]", "Xsent": null, "Osent": 5.0}
|
{"Source": "it_events", "Event": "It takes days", "Xintent": "[\"none\"]", "Xemotion": "[\"none\"]", "Otheremotion": "[\"impatient\"]", "Xsent": null, "Osent": 2.0}
|
{"Seq": "MWAAAGGLWRSRAGLRALFRSRDAALFPGCERGLHCSAVSCKNWLKKFASKTKKKVWYESPSLGSHSTYKPSKLEFLMRSTSKKTRKEDHARLRALNGLLYKALTDLLCTPEVSQELYDLNVELSKVSLTPDFSACRAYWKTTLSAEQNAHMEAVLQRSAAHMRHLLMSQQTLRNVPPIVFVQDKGNAALAELDQLLAVADFGPRDERDNFVQNDFRDPDAPQPCGTTEPTTSSSLCGIDHEALNKQIMEYKRRKDKGLGGLVWQGQVAELTTQMKKGRKRAKPRLEQDSSLKSYLSGEEVEDDLDLVGAPEYECYAPDTEELEAERGGGRTEDGHSCGASRE", "length": 343, "label": 1}
|
{"Seq": "MSVCSSDLSYSSRVCLPGSCDSCSDSWQVDDCPESCCEPPCCAPSCCAPAPCLSLVCTPVSRVSSPCCPVTCEPSPCQSGCTSSCTPSCCQQSSCQLACCASSPCQQACCVPVCCKTVCCKPVCCVPVCCGDSSCCQQSSCQSACCTSSPCQQACCVPICCKPVCSGISSSCCQQSSCVSCVSSPCCQAVCEPSPCQSGCISSCTPSCCQQSSCQPACCTSSSCQQACCVPVCCKTVCCKPVCSEDSSSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCKPVGSVPICSGASSLCCQQSSCQPACCTSSQSQQGCCVPVCCKPVSCVPVCSGASSSCCQQSSCQPACCTTSCCRPSSSVSLLCRPVCRPACCVPVPSCCAPTSSCQPSCCRPASCVSLL", "length": 401, "label": 1}
|
{"Seq": "MKASQCCCCLSHLLASVLLLLLLPELSGPLAVLLQAAEAAPGLGPPDPRPRTLPPLPPGPTPAQQPGRGLAEAAGPRGSEGGNGSNPVAGLETDDHGGKAGEGSVGGGLAVSPNPGDKPMTQRALTVLMVVSGAVLVYFVVRTVRMRRRNRKTRRYGVLDTNIENMELTPLEQDDEDDDNTLFDANHPRR", "length": 190, "label": 1}
|
{"Seq": "MKPGPPHRAGAAHGAGAGAGAAAGPGARGLLLPPLLLLLLAGRAAGAQRWRSENFERPVDLEGSGDDDSFPDDELDDLYSGSGSGYFEQESGIETAMRFSPDVALAVSTTPAVLPTTNIQPVGTPFEELPSERPTLEPATSPLVVTEVPEEPSQRATTVSTTMATTAATSTGDPTVATVPATVATATPSTPAAPPFTATTAVIRTTGVRRLLPLPLTTVATARATTPEAPSPPTTAAVLDTEAPTPRLVSTATSRPRALPRPATTQEPDIPERSTLPLGTTAPGPTEVAQTPTPETFLTTIRDEPEVPVSGGPSGDFELPEEETTQPDTANEVVAVGGAAAKASSPPGTLPKGARPGPGLLDNAIDSGSSAAQLPQKSILERKEVLVAVIVGGVVGALFAAFLVTLLIYRMKKKDEGSYTLEEPKQASVTYQKPDKQEEFYA", "length": 442, "label": 1}
|
{"Seq": "MDARWWAVVVLAAFPSLGAGGETPEAPPESWTQLWFFRFVVNAAGYASFMVPGYLLVQYFRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETTPMWQALKLLFCATGLQVSYLTWGVLQERVMTRSYGATATSPGERFTDSQFLVLMNRVLALIVAGLSCVLCKQPRHGAPMYRYSFASLSNVLSSWCQYEALKFVSFPTQVLAKASKVIPVMLMGKLVSRRSYEHWEYLTATLISIGVSMFLLSSGPEPRSSPATTLSGLILLAGYIAFDSFTSNWQDALFAYKMSSVQMMFGVNFFSCLFTVGSLLEQGALLEGTRFMGRHSEFAAHALLLSICSACGQLFIFYTIGQFGAAVFTIIMTLRQAFAILLSCLLYGHTVTVVGGLGVAVVFAALLLRVYARGRLKQRGKKAVPVESPVQKV", "length": 432, "label": 1}
|
{"Seq": "MKQLFPPPPGTSLTHALGAWRGRERAQAATSLLASSASQFPTAVEDALMSVLTSHCAPSTPAATRAQQTGTRGHIHPACPCQQSCVGASRPPGRPQIFLPLTTALSLEAYAADTCSAADFLHNPSSWGKVWYLNEASFDLYSYHYFW", "length": 147, "label": 1}
|
{"Seq": "MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVLEPANLLAEEKDEDLLFE", "length": 247, "label": 1}
|
{"Seq": "MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGMMGFNNM", "length": 504, "label": 1}
|
{"Seq": "MKERDAAPAERGKPATYTGDKKAKMAAKTNKKWVRLATVFAYVLSVSLAAIVLAVYYSLIWQPVGAGTSGGAAGPPPGGSNATGPSGTSGAAAAGPNTTGSSRREAPRDVPPLQAARPAPPEPPADSPPAGPLERPRGPDEDEEETAAAPGSR", "length": 153, "label": 1}
|
{"asin": "B004N8OJYS", "title": "Genuine Innovations Deluxe Tire Repair and Inflation Wallet", "categories": "[['Sports & Outdoors', 'Cycling', 'Accessories', 'Bike Pumps', 'CO2 Pumps']]", "vertical": "Sports & Outdoors", "label": 21}
|
{"asin": "B0078F665I", "title": "FINGERPROTECT Soccer Goalkeeper Gloves - Kappa Classic Pro - Size 8", "categories": "[['Sports & Outdoors', 'Team Sports', 'Soccer', 'Player Equipment', 'Goalkeeper Gloves']]", "vertical": "Sports & Outdoors", "label": 21}
|
{"asin": "B00EL0HM92", "title": "Sports Illustrated Swimsuit 2014 Engagement Calendar", "categories": "[['Sports & Outdoors', 'Fan Shop', 'Office Products', 'Calendars & Planners']]", "vertical": "Sports & Outdoors", "label": 21}
|
{"asin": "B00HVZN50E", "title": "Motorcycle Full Body Armor Jacket Spine Chest Protection Gear Size S", "categories": "[['Sports & Outdoors', 'Action Sports', 'BMX Equipment', 'Protective Gear']]", "vertical": "Sports & Outdoors", "label": 21}
|
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.